[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69088.1


[Show Plain Result]

## Summary of Sequence Search
   1::491
  43::163  PF00005 0.0% 31.0344827586207  ABC transporter 
 300::429  PF00005 0.0% 28.448275862069  ABC transporter 
  33::50   PF02463 0.0% 55.5555555555556  RecF/RecN/SMC N terminal domain 
 289::304  PF02463 0.0% 62.5  RecF/RecN/SMC N terminal domain 
 401::463  PF02463 0.0% 27.8688524590164  RecF/RecN/SMC N terminal domain 
  29::59   PF03193 0.0% 45.1612903225806  Protein of unknown function, DUF258 
 287::339  PF03193 0.0% 27.5862068965517  Protein of unknown function, DUF258 
  27::77   PF01695 0.0% 29.1666666666667  IstB-like ATP binding protein 
 277::302  PF01695 0.0% 40  IstB-like ATP binding protein 
 406::451  PF01695 0.0% 30.2325581395349  IstB-like ATP binding protein 
  34::73   PF00004 0.0% 36.3636363636364  ATPase family associated with various cellular acti 
 291::307  PF00004 0.0% 35.2941176470588  ATPase family associated with various cellular acti 
  32::75   PF01078 0.0% 31.8181818181818  Magnesium chelatase, subunit ChlI 
 289::307  PF01078 0.0% 36.8421052631579  Magnesium chelatase, subunit ChlI 
  33::85   PF00350 0.0% 28.8461538461538  Dynamin family 
 291::310  PF00350 0.0% 45  Dynamin family 
  34::53   PF05729 0.0% 40  NACHT domain 
 291::312  PF05729 0.0% 31.8181818181818  NACHT domain 
  35::54   PF06414 0.0% 45  Zeta toxin 
 291::311  PF06414 0.0% 33.3333333333333  Zeta toxin 
  33::52   PF03205 0.0% 35  Molybdopterin guanine dinucleotide synthesis protei 
 290::304  PF03205 0.0% 46.6666666666667  Molybdopterin guanine dinucleotide synthesis protei 
   1::491


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGERQCRFTRITRL
PF00005         ------------------------------------------STLlklltgelkptegeievd.ndrkdl
PF00005         ------------------------------------------STLlklltgelkptegeievd.ndrkdl
PF02463         --------------------------------aivGpNGSGKsnvldAil--------------------
PF02463         --------------------------------aivGpNGSGKsnvldAil--------------------
PF02463         --------------------------------aivGpNGSGKsnvldAil--------------------
PF03193         ----------------------------dktsvlvGqSGvGKSsLinallpeldlkvge-----------
PF03193         ----------------------------dktsvlvGqSGvGKSsLinallpeldlkvge-----------
PF01695         --------------------------eqaenlvllGpsGvGKthlAialgvea..vraglsvlfvrledL
PF01695         --------------------------eqaenlvllGpsGvGKthlAialgvea..vraglsvlfvrledL
PF01695         --------------------------eqaenlvllGpsGvGKthlAialgvea..vraglsvlfvrledL
PF00004         ---------------------------------lyGppGtGKTllakavakel.......gvefleisgs
PF00004         ---------------------------------lyGppGtGKTllakavakel.......gvefleisgs
PF01078         -------------------------------lllvGppGsGKtmlakrlpsllpplseeealevakiasv
PF01078         -------------------------------lllvGppGsGKtmlakrlpsllpplseeealevakiasv
PF00350         --------------------------------avvGsqSaGKSSllnaLlgedilprgpgpt.Trrplvl
PF00350         --------------------------------avvGsqSaGKSSllnaLlgedilprgpgpt.Trrplvl
PF05729         ---------------------------------lqGeaGsGKTtLlqklasaw-----------------
PF05729         ---------------------------------lqGeaGsGKTtLlqklasaw-----------------
PF06414         ----------------------------------gGqpGAGKtslaellleela----------------
PF06414         ----------------------------------gGqpGAGKtslaellleela----------------
PF03205         --------------------------------lvvGpkdsGKTTliekllni------------------
PF03205         --------------------------------lvvGpkdsGKTTliekllni------------------


                         -         -         *         -         -         -         -:140
query           SFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLAQQFGISALLDRRFKYLSTGE
PF00005         esdkleklr...igyipqdpllf.peltvrenldmakeekktdkrieevlekvgldelldksrvstLSgG
PF00005         esdkleklr...igyipqdpllf.peltvrenldmakeekktdkrieevlekvgldelldksrvstLSgG
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         .veeLkr---------------------------------------------------------------
PF01695         .veeLkr---------------------------------------------------------------
PF01695         .veeLkr---------------------------------------------------------------
PF00004         ell-------------------------------------------------------------------
PF00004         ell-------------------------------------------------------------------
PF01078         agkke-----------------------------------------------------------------
PF01078         agkke-----------------------------------------------------------------
PF00350         qlgeeeraseravke-------------------------------------------------------
PF00350         qlgeeeraseravke-------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLAD
PF00005         qkqrvalArallkkpklllLDEP-----------------------------------------------
PF00005         qkqrvalArallkkpklllLDEP-----------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           CTLAETGTTTELLQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLS
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         ------------------------------------------------------------------asls
PF01695         ------------------------------------------------------------------asls
PF01695         ------------------------------------------------------------------asls
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           WRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYR
PF00005         -------------------STLlklltgelk.ptegeievdndrkdlesdkleklr..igyipqdpllf.
PF00005         -------------------STLlklltgelk.ptegeievdndrkdlesdkleklr..igyipqdpllf.
PF02463         --------taivGpNGSGKsnvld----------------------------------------------
PF02463         --------taivGpNGSGKsnvld----------------------------------------------
PF02463         --------taivGpNGSGKsnvld----------------------------------------------
PF03193         ------ktsvlvGqSGvGKSsLinallpel........................dlkvg-----------
PF03193         ------ktsvlvGqSGvGKSsLinallpel........................dlkvg-----------
PF01695         f.veqaenlvllGpsGvGKthl------------------------------------------------
PF01695         f.veqaenlvllGpsGvGKthl------------------------------------------------
PF01695         f.veqaenlvllGpsGvGKthl------------------------------------------------
PF00004         ----------lyGppGtGKTllakava-------------------------------------------
PF00004         ----------lyGppGtGKTllakava-------------------------------------------
PF01078         --------lllvGppGsGKtmlakrlp-------------------------------------------
PF01078         --------lllvGppGsGKtmlakrlp-------------------------------------------
PF00350         ----------vvGsqSaGKSSllnaLlged----------------------------------------
PF00350         ----------vvGsqSaGKSSllnaLlged----------------------------------------
PF05729         ----------lqGeaGsGKTtLlqklasawak--------------------------------------
PF05729         ----------lqGeaGsGKTtLlqklasawak--------------------------------------
PF06414         ----------lgGqpGAGKtslaellleela---------------------------------------
PF06414         ----------lgGqpGAGKtslaellleela---------------------------------------
PF03205         ---------lvvGpkdsGKTTlie----------------------------------------------
PF03205         ---------lvvGpkdsGKTTlie----------------------------------------------


                         -         -         -         -         *         -         -:420
query           VSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
PF00005         .peltvrenldmakeekk.........tdkrieevlekvgldelldksrvstLSgGqkqrvalArallkk
PF00005         .peltvrenldmakeekk.........tdkrieevlekvgldelldksrvstLSgGqkqrvalArallkk
PF02463         --------------------------------------------------lLSgGektLvalaLlfAiqk
PF02463         --------------------------------------------------lLSgGektLvalaLlfAiqk
PF02463         --------------------------------------------------lLSgGektLvalaLlfAiqk
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         -------------------------------------------------------dgrleralkrlakv.
PF01695         -------------------------------------------------------dgrleralkrlakv.
PF01695         -------------------------------------------------------dgrleralkrlakv.
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSGRCN
PF00005         pklllLDEP-------------------------------------------------------------
PF00005         pklllLDEP-------------------------------------------------------------
PF02463         vkpaplyllDeidaaLDeknvskvaellk..eksknaQfivis---------------------------
PF02463         vkpaplyllDeidaaLDeknvskvaellk..eksknaQfivis---------------------------
PF02463         vkpaplyllDeidaaLDeknvskvaellk..eksknaQfivis---------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         dllilDd..lgllplseeeakllfellskry---------------------------------------
PF01695         dllilDd..lgllplseeeakllfellskry---------------------------------------
PF01695         dllilDd..lgllplseeeakllfellskry---------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           N---------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF01695         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF05729         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------