[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69275.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  74::276  PF01557 0.0% 44  Fumarylacetoacetate (FAA) hydrolase family 
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYYQEVTFLPVID
PF01557         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
PF01557         ---kiiavglnyaehaeeagsagleppdsgvplepvfflkppsslvgpgtpirrPagsrkldyEvELavv


                         +         -         -         -         -         *         -:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
PF01557         igkplgevltaeealdaiagytlanDvsaRdlqgeealplgwfl.aksfdtfapiGpwivtpdelgdpad


                         -         -         -         +         -         -         -:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRY
PF01557         lalrlrvngelvqrsstsdlifspaqliahlsrgltLepGdlvltGTpsgvga.fetlrflqpgDt----


                         -         *         -         -         -         -         +:350
query           LTSSVSWHDGRK----------------------------------------------------------
PF01557         ----------------------------------------------------------------------