[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69484.1


[Show Plain Result]

## Summary of Sequence Search
   1::648
 264::291  PF02687 0.0% 18.5185185185185  Predicted permease 
 470::641  PF02687 0.0% 27.810650887574  Predicted permease 
  48::172  PF00005 0.0% 39.6551724137931  ABC transporter 
  35::52   PF02463 0.0% 50  RecF/RecN/SMC N terminal domain 
 142::217  PF02463 0.0% 21.3333333333333  RecF/RecN/SMC N terminal domain 
  23::55   PF03193 0.0% 34.375  Protein of unknown function, DUF258 
   1::648


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR
PF02687         ----------------------------------------------------------------------
PF02687         ----------------------------------------------------------------------
PF00005         -----------------------------------------------STLlklltgelkptegeievd.n
PF02463         ----------------------------------sftaivGpNGSGKsnvld------------------
PF02463         ----------------------------------sftaivGpNGSGKsnvld------------------
PF03193         ----------------------gleelaellkd.ktsvlvGqSGvGKSsLinall---------------


                         -         -         *         -         -         -         -:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKKRQARARELLLRLGLSDRVDY
PF02687         ----------------------------------------------------------------------
PF02687         ----------------------------------------------------------------------
PF00005         drkdlesdkleklr...igyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldk
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQA
PF02687         ----------------------------------------------------------------------
PF02687         ----------------------------------------------------------------------
PF00005         srvstLSgGqkqrvalArallkkpklllLDEP--------------------------------------
PF02463         -kelLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfivislreem
PF02463         -kelLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfivislreem
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGII
PF02687         -----------------------------------------------------lqls.siillllllsvl
PF02687         -----------------------------------------------------lqls.siillllllsvl
PF00005         ----------------------------------------------------------------------
PF02463         lekadkl---------------------------------------------------------------
PF02463         lekadkl---------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGIASVVSIVVVGDAAKQMVLADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQLWVNSATP
PF02687         illlavlilll-----------------------------------------------------------
PF02687         illlavlilll-----------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVSKSLRLRYGNIDIAVNANGVSGDYFNVYGMSFREGNTFNDVQQQDRAQVVVLDANTRRQLFPNKANVV
PF02687         ----------------------------------------------------------------------
PF02687         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGVDSDQAEQQLT
PF02687         -------------------------------------------------nsllvklkdpedlealaeelk
PF02687         -------------------------------------------------nsllvklkdpedlealaeelk
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMA
PF02687         klllssldvvstdsadslsdqllqls...siillllllsvlilllavlilllllsisirerrkeigilka
PF02687         klllssldvvstdsadslsdqllqls...siillllllsvlilllavlilllllsisirerrkeigilka
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           VGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQLFLPGWEIGFSLTALASAFLCSTFTGILFGW
PF02687         lGaskkqifkqlllealligliglllGlllglllaqllsqallkfsssslpisldpisillllllillia
PF02687         lGaskkqifkqlllealligliglllGlllglllaqllsqallkfsssslpisldpisillllllillia
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LPARNAARLDPVDALARE----------------------------------------------------
PF02687         llasllparri-----------------------------------------------------------
PF02687         llasllparri-----------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------