[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69516.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   4::100  PF00893 0.0% 30.3370786516854  Small Multidrug Resistance protein 
  32::107  PF00892 0.0% 22.3684210526316  EamA-like transporter family 
  37::52   PF10639 0.0% 31.25  Uncharacterised protein family UPF0546 
  50::107  PF10639 0.0% 27.5862068965517  Uncharacterised protein family UPF0546 
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
PF00893         ---vllviAillevigailLkl......segftk..lipsllvivgygisfllLskalkslpvsvaYavw
PF00892         -------------------------------slkdilallllgllgtvlgyllffyalkktsasnaslit
PF10639         ------------------------------------ktvlgmllvlvgigSvlfflllgkaelslavpia
PF10639         ------------------------------------ktvlgmllvlvgigSvlfflllgkaelslavpia


                         -         -         *         -         -         -         -:140
query           SLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA-----------------------------
PF00893         sGiGtvlttlvgillfgeslslkkliglal----------------------------------------
PF00892         slePvftillsvlllgekltlkqllgivlillGvlll---------------------------------
PF10639         NslafvfTvltelllgekvlkkktvlgmllvlvgial---------------------------------
PF10639         NslafvfTvltelllgekvlkkktvlgmllvlvgial---------------------------------