[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69590.1


[Show Plain Result]

## Summary of Sequence Search
   1::419
   4::399  PF00890 0.0% 22.0472440944882  FAD binding domain 
   4::132  PF01266 0.0% 22.7642276422764  FAD dependent oxidoreductase 
 258::347  PF01266 0.0% 24.7058823529412  FAD dependent oxidoreductase 
   3::38   PF01494 0.0% 33.3333333333333  FAD binding domain 
   1::419


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDITAGLDALCRQ
PF00890         ---DvvViGsGlAGlaAAleaaeaglkvavvekeqetggatawsqGgidavlspeqkkagikdspdlhrt
PF01266         ---dvviiGgGivGlstAyeLarrglkVtllekgdiasgaSgrngglihagl....lkerdprllrlale
PF01266         ---dvviiGgGivGlstAyeLarrglkVtllekgdiasgaSgrngglihagl....lkerdprllrlale
PF01494         --tdVlIVGaGpaGlmlallLseaGvrvvlvekhsttv--------------------------------


                         -         -         *         -         -         -         -:140
query           APEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLRSTWLSSPEVPVWPLSAQRIC
PF00890         dtlkaldela.dqplveafveaapeavdeleel....gvpfsrtedg.pvdlrelGglsat.rtlhdaad
PF01266         sldl.lrelaaetgidvdfrrtgvldlasdeeeleelerlaerarangl.dvellsaeevre--------
PF01266         sldl.lrelaaetgidvdfrrtgvldlasdeeeleelerlaerarangl.dvellsaeevre--------
PF01494         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLYDALSP
PF00890         arretlvtghallarllesareagkvdfqerhradeLivedgrvtGvvvenp......rsgrevriraka
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IATNCDMIIMPACFGLANDTLWRWLNERLPCALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVK
PF00890         avvlatgGfgrdrrallkellgaaaeaettnapantGdgialalragaa.lnddrmeevqfhPtslvpir
PF01266         -----------------------------------------------lvkalaraaeelGveiiegtkVt
PF01266         -----------------------------------------------lvkalaraaeelGveiiegtkVt
PF01494         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KVTCRRGTVSEIWTRNHADIPLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFF
PF00890         dgsgiLitealrgeGgilvd.kdGrrFmnelasrdvvsrailekeiaeggseanvyldadhgldaealea
PF01266         glereggrvsgvrtedg...siradkvvlAaGa..wsskllkllgldlpirpvrgqvlvtepltdel---
PF01266         glereggrvsgvrtedg...siradkvvlAaGa..wsskllkllgldlpirpvrgqvlvtepltdel---
PF01494         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ-
PF00890         tleaineeaengldkdfgrgidpadrpipgpfyavkvvpaqhytmgGvr---------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------