[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69765.1


[Show Plain Result]

## Summary of Sequence Search
   1::115
   1::114  PF07037 0.0% 63.716814159292  Putative transcription regulator (DUF1323) 
   5::106  PF02316 0.0% 30.3921568627451  Mu DNA-binding domain 
   1::26   PF01381 0.0% 38.4615384615385  Helix-turn-helix 
   1::115


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPAS
PF07037         mtpeelaellGyarqtinrWvRkegWkteplpGvkGGkarlihideqvrefirnaealrnsaalyrveee
PF02316         ----elaglPGlPktaagvtkkAkkegWkkrkreGvkGGkavEYdvnslPketraallkrlGlietgaal
PF01381         lsqeeLAeklGvsrstisriEnGern--------------------------------------------


                         -         -         *         -         -         -         -:140
query           NASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSK-------------------------
PF07037         paey.avtedaeleallietleeltpseqkklaelllreGiagl--------------------------
PF02316         sekarktelvetldeelitakeelapDeqrkalell----------------------------------
PF01381         ----------------------------------------------------------------------