[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69854.1


[Show Plain Result]

## Summary of Sequence Search
   1::71
   1::65   PF10953 0.0% 80  Protein of unknown function (DUF2754) 
   1::71


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIRRREDDEVKDA
PF10953         mklsakirrdwhyyavalGlifilnGvvGllGfeakGwqtyavGlvtwvisfwiaGliirrrpee-----


                         -         -         *         -         -         -         -:140
query           R---------------------------------------------------------------------
PF10953         ----------------------------------------------------------------------