[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69863.1


[Show Plain Result]

## Summary of Sequence Search
   1::417
  41::268  PF07690 0.0% 25.5506607929515  Major Facilitator Superfamily 
 272::407  PF07690 0.0% 30.1470588235294  Major Facilitator Superfamily 
  71::215  PF00083 0.0% 25  Sugar (and other) transporter 
 279::407  PF00083 0.0% 21.7054263565891  Sugar (and other) transporter 
   1::417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRTTILDDATASDIDEQRHSQPVQFIKRGTAPFMRVTLALFSAGLATFALLYCVQPILPVLSQEFGVSP
PF07690         ----------------------------------------lllaaflaalarsilgpalplalaedlgis
PF07690         ----------------------------------------lllaaflaalarsilgpalplalaedlgis
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASSSVSLSISTAMLAIGLLFTGPLSDAIGRKPVMVTALLLASCCTLLSTMMTSWHGILIMRALIGLSLSG
PF07690         pseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllll.fasslwalllvlrvlqGlg
PF07690         pseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllll.fasslwalllvlrvlqGlg
PF00083         vlsglivssflvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlg
PF00083         vlsglivssflvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlg


                         +         -         -         -         -         *         -:210
query           VAAVGMTYLSEEIHPSFVAFSMGLYISGNSIGGMSGRLLSGVMTDFFNWRIALAAIGCFALASALMFWKI
PF07690         agalfpagaaliadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlv
PF07690         agalfpagaaliadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlv
PF00083         vGlisvlvPmyisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallll
PF00083         vGlisvlvPmyisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallll


                         -         -         -         +         -         -         -:280
query           LPASQHFRPTSLRPKTLFINFRLHWRDRGLPLLFAEGFLLMGAFVTLFNYIGYRLMLSPWELSQAVVGLL
PF07690         llllprepperkrkspaeelrkepaplvpawklllkppvlwllialllfffvfsgllt---ispseigwl
PF07690         llllprepperkrkspaeelrkepaplvpawklllkppvlwllialllfffvfsgllt---ispseigwl
PF00083         .llll---------------------------------------------------------------iv
PF00083         .llll---------------------------------------------------------------iv


                         -         *         -         -         -         -         +:350
query           SVAYLTGTWSSPKAGAMTSRYGRGPVMLFSTAVMLGGLLLTLFTSLWLIFAGMLLFSAGFFAAHSVASSW
PF07690         ltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpag
PF07690         ltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpag
PF00083         ssflvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvl
PF00083         ssflvgaliGslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvl


                         -         -         -         -         *         -         -:420
query           IGPRARRAKGQASSLYLFSYYLGSSIAGTLGGVFWHSYGWNGVGGFIALMLVLAILVGTRLHHRLHA---
PF07690         aaliadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsll-------------
PF07690         aaliadwfpkeergralgllsagfslGailgpllggllasslgWravFlilailsll-------------
PF00083         vPmyisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlv-------------
PF00083         vPmyisEiApkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlv-------------