[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF69930.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
  12::129  PF01797 0.0% 40.6779661016949  Transposase IS200 like 
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGDEKSLAHTRWNCKYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP
PF01797         -----------snlkyhlvfvtkyRrkvltdeveerlkeiireiaeekevelleingmpDHvHllvelpp


                         -         -         *         -         -         -         -:140
query           KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIKHQLEEDKMGEQLS
PF01797         klsisklvqklkgassrlirkefpelkkkklkkeslWqrgyfvstvggasletvkrYIe-----------


                         +         -         -         -         -         *         -:210
query           IPYPGSPFTGRK----------------------------------------------------------
PF01797         ----------------------------------------------------------------------