[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF70211.1


[Show Plain Result]

## Summary of Sequence Search
   1::396
  66::211  PF00529 0.0% 26.0869565217391  HlyD family secretion protein 
 210::316  PF00529 0.0% 19.047619047619  HlyD family secretion protein 
   1::396


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKINQHDAAMDDPDIQRERAFSGAGRIVLICSLLFLILGIWAWFGRLDEVSTGNGKVIPSSREQVLQSLD
PF00529         -----------------------------------------------------------------vqpqv
PF00529         -----------------------------------------------------------------vqpqv


                         -         -         *         -         -         -         -:140
query           GGILAQLTVREGDRVQANQIVARLDPTRLASNVGESAAKYRASLASSARLTAEVNDLPLAFPAELNGWPD
PF00529         sGivievlvkeGdrVkaGdvLvrlDptpaqaalaraeaelaaaqadaaqarlaaekrerlqalvkqqaa.
PF00529         sGivievlvkeGdrVkaGdvLvrlDptpaqaalaraeaelaaaqadaaqarlaaekrerlqalvkqqaa.


                         +         -         -         -         -         *         -:210
query           LIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRS
PF00529         .......esekeadaarrearealaasqalaaskaeleaardnlasaeaalpaslgsikasqatlgallg
PF00529         .......esekeadaarrearealaasqalaaskaeleaardnlasaeaalpaslgsikasqatlgallg


                         -         -         -         +         -         -         -:280
query           QYYVQAREALSKANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
PF00529         eevsvgspllgvvpfedvevdanlketqlrlvrpgqkaplsgdvyvlavlteGdvvga..ilmptvassr
PF00529         eevsvgspllgvvpfedvevdanlketqlrlvrpgqkaplsgdvyvlavlteGdvvga..ilmptvassr


                         -         *         -         -         -         -         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFIRTHQDY
PF00529         llpveaqvavvnidkvvqglpVkigldpafnlsttp----------------------------------
PF00529         llpveaqvavvnidkvvqglpVkigldpafnlsttp----------------------------------


                         -         -         -         -         *         -         -:420
query           LQNKSGRRFSIVPGMIATVDIKTGEKTIVDYLIKPFNRAKEALRER------------------------
PF00529         ----------------------------------------------------------------------
PF00529         ----------------------------------------------------------------------