[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF70405.1


[Show Plain Result]

## Summary of Sequence Search
   1::478
   8::294  PF00483 0.0% 44.6280991735537  Nucleotidyl transferase 
 323::473  PF01050 0.0% 76.8211920529801  Mannose-6-phosphate isomerase 
 390::457  PF07883 0.0% 30.8823529411765  Cupin domain 
   1::478


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
PF00483         -------avILaGGsGtRLwPltrtlakklvpvlgke.rliqytlsrlansgieeiivvltqehrflvae
PF01050         ----------------------------------------------------------------------
PF07883         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QLRQLNKLTENIILEPAGRNTAPAIALAALAATRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
PF00483         qlregsklgvevlialepegrgtAdAvalaaelledeks..delvlvLagDhlikd..ayeeavkkaiek
PF01050         ----------------------------------------------------------------------
PF07883         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
PF00483         aadg.tvtfgivpveeatgYGvieid.......eeg...rverfvEKPkeakaselassgiYvfnsgvll
PF01050         ----------------------------------------------------------------------
PF07883         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
PF00483         flak.yleelkrgedeitdilpaaleegkealaflrkgea............................yW
PF01050         ----------------------------------------------------------------------
PF07883         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRHAVQDVKK
PF00483         sDvGtvdslleane--------------------------------------------------------
PF01050         ------------------------------------------vGvedlvvvetkdavlvadkdkvqdvkk
PF07883         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
PF00483         ----------------------------------------------------------------------
PF01050         iveklkaeereeaelhrevyrPWGkydvleegeryqvkritvkPgeklslqkhhhraehWvvvsGtakvt
PF07883         ---------------------------------------velppGesapshrHpgedeffyVleGegelt


                         -         -         +         -         -         -         -:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI------------
PF00483         ----------------------------------------------------------------------
PF01050         vdeevllltenesiyiplgaihrlenpgkiplelievqsGsylgeddivrled-----------------
PF07883         vdgeeveleaGdsvyfpagtpHrfrNtgdeparllvv---------------------------------