[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF70471.1


[Show Plain Result]

## Summary of Sequence Search
   1::94
   4::91   PF01386 0.0% 44.3181818181818  Ribosomal L25p family 
   1::94


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
PF01386         ---lkaekReevgkgaarrlRregkvPAviYgkgkepvsisvdekelekllekeagestvleLkidgkke


                         -         -         *         -         -         -         -:140
query           KVKAQAVQRHAYKPKLTHIDFVRA----------------------------------------------
PF01386         kvlvkdiqrhpvkdkilHvDF-------------------------------------------------