[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF65890.1


[Show Plain Result]

## Summary of Sequence Search
   1::350
   7::349 8.1e-151 59.2% 0046975 00469751 1/1   ase                                     
   8::349 4.9e-133 59.7% 0047183 00471831 1/1   ase                                     
  36::348  1.1e-77 42.8% 0046288 00462881 1/1   ase                                     
  52::336  4.4e-75 42.8% 0046878 00468781 1/1   ase                                     
   5::350  1.6e-66 31.5% 0049279 00492791 1/1   ase                                     
  37::350  1.9e-43 24.3% 0048496 00484961 1/1   ase                                     
  36::348  2.1e-20 21.0% 0051114 00511141 1/1   ase                                     
   1::350


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPAAAK
00469751   1/1  ------dlrilgikplispaelleelPlseellelvlesreeildillgeddrllviaGPCsiedeeaal
00471831   1/1  -------lrilsleplpspeelleelplsealaelvlesrveivdillggddrllviaGPCsiedeeaal
00462881   1/1  -----------------------------------vlnsrikignilignddrllviaGpcsieseeaal
00468781   1/1  ---------------------------------------------------drllviaGpCsieseeaal
00492791   1/1  ----miivlklgaaeeeleevlelieelglkvllivglerlligllgdlsvllieplislagveevlpls
00484961   1/1  ------------------------------------edtvvkigdiliggdkpllliaGpcvieseelal
00511141   1/1  -----------------------------------lvlelikivsrligeddpllvIaeigvnhngdlel


                         -         -         *         -         -         -         -:140
query           EYAARLLALRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
00469751   1/1  eyaerLkelaeklkdgllivmrvyfeKPrttvgwkGlindPdldgsfdieeGLkilrkllldlaelglpv
00471831   1/1  eyAerLkelgaklkddllivlRvyfeKPrttvgfkGlindPdldgsfdieeGLkilrkllldleelglpv
00462881   1/1  eyAkrlielakkl..gldivfkvsfekpnrtsvdsfkgl..............gleeglklllevaeelg
00468781   1/1  eyaerlkelgaklldillivlrsyakkpRtsvgsfkGlgleegldilaevkeel.............glp
00492791   1/1  epyklvsrearpeitviliggvligddrplviaGpcsieslelalelaealkea.......gadavrfgt
00484961   1/1  eiAealkelaeel..giplvrkgsfkkapRTspysfrglg.........leeglkilaev...keelglp
00511141   1/1  akeliliAgpcgaesvkfqlltaetlvkklgili.lkgsadkprtslysflglgleglkiLaevaeelgl


                         +         -         -         -         -         *         -:210
query           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
00469751   1/1  atevldpitpqyvadlvdwlaiGArttesqlllelasglskPvglKngtdgnlevalnailaasaphlfl
00471831   1/1  atEvldpispqyvadlvdwlaIGArttesqlllelasglskPvglKngtdgtlevaldAilaasaphffl
00462881   1/1  lpvltevldpisvdlladlvdvlqIgArltentdllrevAs.tgkpvllkngtsasleealnavek....
00468781   1/1  vatevldpiqvelvadlvdvlqigArltentdlleaaagtgkpvllKkGtfltleealnave........
00492791   1/1  fkprtsvysfqglgle...........glkilrell...eelglpvltevldpesvdlladlvdilqigA
00484961   1/1  vvtevhdpeqvelvaevvdvlqigArlmrntdlleavaktgkpvllkkgqfltleemlnaae........
00511141   1/1  pvltevfdlesvdllaelgvdvlkigafeltntdllravak.tgkpvilktGmatleeillavekl....


                         -         -         -         +         -         -         -:280
query           SVTKWGHSAIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQME
00469751   1/1  gvnkeGlaaivlttGnpdvhlilRGgsfpnydlvslalalvllakaglnlpvvvDasHsnsgkdlerqll
00471831   1/1  gvdkegvaeivltsGnpdvhlilRGgrtgpnylvldlaavplllekagl.P.vivDasHangnkdlvrql
00462881   1/1  ..............iltaGnpdiillergssypynylvvdlraipi.lkklflglpvivDasHsnslkgg
00468781   1/1  ..........kiltaGnpnvilieRGgstgpnylvldlralpvlle..glp..vivDashsvslkgglgq
00492791   1/1  rnmtnfdlleaaaktgkpvllkrGmsatleeilnAv..................eyilsagnpnviller
00484961   1/1  ..........kilsaGndnvilcerGistgynrlvldlralpvlkelltglPvivDpsHavqlpgglgds
00511141   1/1  .................reagnd..lvllrctrgyptpyenldlraipvlkel.flpvivglSdHslglp


                         -         *         -         -         -         -         +:350
query           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRG
00469751   1/1  vaedvleqraagavgidGvmiEshldpgnqlsdgpnsltygvsiTDaclgwedteklLrllaeavklrr-
00471831   1/1  avledvleqraagaagidGlmiEshlsdGnqslplddleellyglsitdaclgwedtekllrelaeavk-
00462881   1/1  lsdhtlgvrelvlalaraavalgadGlmiEsHldpdnalsdgpqsltlg.sltdllidlkatekllgs--
00468781   1/1  lsvgrrvlvlalaraavalgadGlmiEsHldpdnalsDgpqslpldeleellygls--------------
00492791   1/1  GirtfypytrnvvdlraipllkelfglpvivDpsHglsdhelvlqlavaavalg........adGlmiEv
00484961   1/1  sgGlrelvlplaraavaaG...adGlfiEvhp...........dPdkalsdgpqalpldeleelleelra
00511141   1/1  .....laraA.....valG.....alfiEkHftpdkalsgpDgpaslepd.elealveelraiekalg--