[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF65947.1


[Show Plain Result]

## Summary of Sequence Search
   1::353
 294::346  4.5e-17 50.9% 0042711 00427111 1/1   doxin-like                              
 294::346  5.5e-17 52.8% 0035679 00356791 1/1   doxin-like                              
 293::345  1.9e-16 45.3% 0039154 00391541 1/1   doxin-like                              
 293::346  2.1e-16 50.0% 0045630 00456301 1/1   doxin-like                              
 294::344  7.7e-16 49.0% 0039201 00392011 1/1   doxin-like                              
 293::344    2e-15 46.2% 0052486 00524861 1/1   doxin-like                              
 293::344  5.5e-15 51.9% 0043187 00431871 1/1   doxin-like                              
 293::344  5.6e-15 51.9% 0045435 00454351 1/1   doxin-like                              
 289::346  6.8e-15 43.1% 0046413 00464131 1/1   doxin-like                              
 292::347  1.5e-14 46.4% 0043471 00434711 1/1   doxin-like                              
 293::344  1.9e-10 51.1% 0045637 00456371 1/1   doxin-like                              
 288::348  0.00014 34.1% 0036623 00366231 1/1   doxin-like                              
   1::353


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVAT
00427111   1/1  ----------------------------------------------------------------------
00356791   1/1  ----------------------------------------------------------------------
00391541   1/1  ----------------------------------------------------------------------
00456301   1/1  ----------------------------------------------------------------------
00392011   1/1  ----------------------------------------------------------------------
00524861   1/1  ----------------------------------------------------------------------
00431871   1/1  ----------------------------------------------------------------------
00454351   1/1  ----------------------------------------------------------------------
00464131   1/1  ----------------------------------------------------------------------
00434711   1/1  ----------------------------------------------------------------------
00456371   1/1  ----------------------------------------------------------------------
00366231   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQRVADEIII
00427111   1/1  ----------------------------------------------------------------------
00356791   1/1  ----------------------------------------------------------------------
00391541   1/1  ----------------------------------------------------------------------
00456301   1/1  ----------------------------------------------------------------------
00392011   1/1  ----------------------------------------------------------------------
00524861   1/1  ----------------------------------------------------------------------
00431871   1/1  ----------------------------------------------------------------------
00454351   1/1  ----------------------------------------------------------------------
00464131   1/1  ----------------------------------------------------------------------
00434711   1/1  ----------------------------------------------------------------------
00456371   1/1  ----------------------------------------------------------------------
00366231   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPIPESIWQTHPQPPITPELPPQPAGLMNGAFIAHEIAERVKQPVKEPHIINLTLLPVNDADREYLDHFL
00427111   1/1  ----------------------------------------------------------------------
00356791   1/1  ----------------------------------------------------------------------
00391541   1/1  ----------------------------------------------------------------------
00456301   1/1  ----------------------------------------------------------------------
00392011   1/1  ----------------------------------------------------------------------
00524861   1/1  ----------------------------------------------------------------------
00431871   1/1  ----------------------------------------------------------------------
00454351   1/1  ----------------------------------------------------------------------
00464131   1/1  ----------------------------------------------------------------------
00434711   1/1  ----------------------------------------------------------------------
00456371   1/1  ----------------------------------------------------------------------
00366231   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLE
00427111   1/1  ----------------------------------------------------------------------
00356791   1/1  ----------------------------------------------------------------------
00391541   1/1  ----------------------------------------------------------------------
00456301   1/1  ----------------------------------------------------------------------
00392011   1/1  ----------------------------------------------------------------------
00524861   1/1  ----------------------------------------------------------------------
00431871   1/1  ----------------------------------------------------------------------
00454351   1/1  ----------------------------------------------------------------------
00464131   1/1  ----------------------------------------------------------------------
00434711   1/1  ----------------------------------------------------------------------
00456371   1/1  ----------------------------------------------------------------------
00366231   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           WLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGNNS
00427111   1/1  -------------akyeClvCgyvydpaegdpeegiapgtpfedlpddwlCPvCgagkedfellee----
00356791   1/1  -------------akyeClvCgyvydpalgdpeegiapgtpfedlPddwlCPvCgagkedfellee----
00391541   1/1  ------------lkkyvClvCgyvydpaegdpeegiapgtafedlpddwlCPvCgagkelfelle-----
00456301   1/1  ------------lkkyeClvCgyvydpalgdpeegiapgtafedlpddwlCPvCgagkedfellee----
00392011   1/1  -------------akyvClvCgyvydpalgdpeegiapgtafedlPddwvCPvCgagkedfekl------
00524861   1/1  ------------lkkylClvCgyvydpelGdpesgiapgtafedlpddwlCPvCgagkelflll------
00431871   1/1  ------------lkkyeClvCgyvydpalgdpeegiapgtpfedlpddwlCPvCgagkedfepa------
00454351   1/1  ------------lkkyeClvCgyvydpalGdpeegiapgtpfedlpddwlCPvCgapkedfepa------
00464131   1/1  --------llllmkkyvCtvCgyvydpeegdelegiepgtpfedlpedwlCPvCgapkskfellee----
00434711   1/1  -----------emkkyvClvCgyiydpalgdpeegiapgtpfedlPddwlCPvCgagkelfelleee---
00456371   1/1  ------------lkkyeClvCgyvydpaegd.......gtafedlpddwlCPvCgagkelfepa------
00366231   1/1  -------feleelklyvClvCgyiyeg...............edlP..elCPvCgapkelfelleenl--


                         -         -         -         -         *         -         -:420
query           CKD-------------------------------------------------------------------
00427111   1/1  ----------------------------------------------------------------------
00356791   1/1  ----------------------------------------------------------------------
00391541   1/1  ----------------------------------------------------------------------
00456301   1/1  ----------------------------------------------------------------------
00392011   1/1  ----------------------------------------------------------------------
00524861   1/1  ----------------------------------------------------------------------
00431871   1/1  ----------------------------------------------------------------------
00454351   1/1  ----------------------------------------------------------------------
00464131   1/1  ----------------------------------------------------------------------
00434711   1/1  ----------------------------------------------------------------------
00456371   1/1  ----------------------------------------------------------------------
00366231   1/1  ----------------------------------------------------------------------