[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66015.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
   8::152  3.2e-35 36.4% 0040641 00406411 1/1   yme-like                                
   9::131  1.7e-32 37.7% 0040570 00405701 1/1   yme-like                                
  15::124  2.4e-31 32.7% 0039048 00390481 1/1   yme-like                                
   9::127    5e-31 36.4% 0039764 00397641 1/1   yme-like                                
   9::134  9.5e-31 39.2% 0038595 00385951 1/1   yme-like                                
   8::131    4e-30 39.0% 0046990 00469901 1/1   yme-like                                
  12::124  8.8e-30 31.9% 0038053 00380531 1/1   yme-like                                
   9::131  3.5e-29 35.2% 0045261 00452611 1/1   yme-like                                
  11::147  1.9e-28 30.4% 0045677 00456771 1/1   yme-like                                
  17::124  4.3e-28 40.2% 0047673 00476731 1/1   yme-like                                
   8::131  1.9e-27 36.7% 0042950 00429501 1/1   yme-like                                
  16::143  3.5e-26 30.6% 0042970 00429701 1/1   yme-like                                
   9::134  5.8e-26 36.1% 0047448 00474481 1/1   yme-like                                
  19::121  9.8e-22 37.3% 0053219 00532191 1/1   yme-like                                
  11::132    7e-18 27.6% 0041358 00413581 1/1   yme-like                                
  19::128  6.7e-14 30.6% 0046807 00468071 1/1   yme-like                                
  18::112    8e-11 31.2% 0037418 00374181 1/1   yme-like                                
  11::132  2.2e-10 25.0% 0038582 00385821 1/1   yme-like                                
   1::146  2.1e-05 23.6% 0043002 00430021 1/1   yme-like                                
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
00406411   1/1  -------aklltrcelarelcflgaagfygvslallvcialvESgfntsavnrnkngstdyGlfQInsry
00405701   1/1  --------klltrcelaralcflgaagfygvslallvclaevESgfntgavnrnkngstdyGlfQInsry
00390481   1/1  --------------kvltrcelaralkrlgldgllladwvcialveSgfntsavnrvnkngstdyGlfQI
00397641   1/1  --------kvltrcelarelcllgaagfygvslallvciaevESgfntsavnrnsngstdyGlfQInsry
00385951   1/1  --------klllrcelaralcflgadgfygislallvcialvESgfntgavnrnkngstdyGlfQInsry
00469901   1/1  -------AkvlsrcelaralcflgaagrygislallvciaevESgfntgavnrnkngstdyGlfQInsry
00380531   1/1  -----------kvltrcelacilkaagfpgvslallvcialveSgfntsavnrnkngstdyGlfQInsry
00452611   1/1  --------kvltrcelaralcllgaagfpgislalwvciaevESgfntsavnrvnkngstdyGlfQInsr
00456771   1/1  ----------slslllllllldtlgllallllllglavlglvaskaladallarllpylplieeaakryg
00476731   1/1  ----------------kvftrcelarelcflgaagfygislallvciaevESgfntsavnrnkngstdyG
00429501   1/1  -------akvltrcelaralcflgaagfygvslallvcialvESgfntsavnrvnkngstdyGlfQInsr
00429701   1/1  ---------------ekyldlikkaakkygvppalllaiarqESgfnpnavspag....avGlmQvmpat
00474481   1/1  --------kvftrcelaralcflgaagfygvslallvaiaeheSgfntsavnrnnsdgstdyGlfQInsr
00532191   1/1  ------------------arelkeagldgfpgvslalwvciaeveSgfntsavnrlnsdgstdyGlfQIn
00413581   1/1  ----------kvltrcelakelkgadgfpgislanwvclalhesgfntsavn.nkngstdyGlFQInsry
00468071   1/1  ------------------akvlsrcelareLkgaagfpgvslalwvciaeheSgfntsavn.nkngstdy
00374181   1/1  -----------------lakelkgldgfpgislanwvclalhesgfntsavn.nnngstdyGlFQInsry
00385821   1/1  ----------kvlercelakeLkgldgfpgvslanwvclaehesgfntsavn.ngdgstdyGlFQInsry
00430021   1/1  llllllllalaaaagagfedwlaglralalaagvseatldaalaglkydprvirldrgqaeftlalsplg


                         -         -         *         -         -         -         -:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
00406411   1/1  wcnlgktgis.rnlcldpcsnlldddivgaiilakkivregngwnawgaYnsgckgk....rlsyalkvl
00405701   1/1  wcrlgktggsknlcgiscsdLlddditnaivcakilvkllqggga.wvawgaycsgtdlsn---------
00390481   1/1  nsrywcslgktpgnlcgiscsdLldddicdniacakkilkeqgfeawvawkalc----------------
00397641   1/1  wcrlgktpgsgnlcgiscsdLlddditddivcakllvkaiqgfga.Wvawgsycsgt-------------
00385951   1/1  wcdlgktggsrn.lcldpcsnllddditgaiilakkivrrgngwnawgaynsgcpgkrlsyark------
00469901   1/1  wcslgktlrslnlcgiscsdlldddctnaivcakillkliqgfga.Wvawgaycsgtpllr---------
00380531   1/1  WcsdglpplnlcgiscsdLldddicdniacakkilkehgfrawvawkalcagns----------------
00452611   1/1  yWCndghlprlnlcgiscsdLldd.dinddiacaklivliqeggnawvawgaycsgtdlld---------
00456771   1/1  vppallaAiarqESgfnpnavspwgngagavGlmQimpatarel.glpgsvddll.dpedniragarylr
00476731   1/1  lfQInsrywcsdgktlpslnlcgiscsdLl.dpdinddvgcaklivkihqggna----------------
00429501   1/1  ywcndghlpslnlcgiscsdLldd.dinddvacakl...ivergngwnawgayksyckgkd---------
00429701   1/1  aralgkllglsyggsvddlfdpetniragarylrdlldrfggdwllalaaYnaGpgrvrralglagrgld
00474481   1/1  ywcsdgktlgslnlcgiscsdLldd...nitdaawclkkivkrhg.gwnawgaynsgckgkdls------
00532191   1/1  srywcsdgltlgslnlcgiscsdLl.dddinddvacaklivklpqggnaWv-------------------
00413581   1/1  WCsdgktlgslnlcgiscsdLldd.dinddvacaklilk....gqgfnawvawkslckgkll--------
00468071   1/1  GlFQInsrywcslgktpgsgnlcgiscsdLldd.ditddvacaklildshgfgawvaw------------
00374181   1/1  wCsdgktlrslnlcgiscsdLldd.ditddvacakkildeqg----------------------------
00385821   1/1  wCndgktlgslnlcgiscsdLlddditddvacaklivdsq.....glnawvawknlCkgkll--------
00430021   1/1  llkslleylgrrlsearvarglaflakyaallrraekkygvppellaAiigvESrfgpyagnfdvldaLa


                         +         -         -         -         -         *         -:210
query           KLKGMSAEEKNKRLSIAANK--------------------------------------------------
00406411   1/1  dvllrlvlvlsp----------------------------------------------------------
00405701   1/1  ----------------------------------------------------------------------
00390481   1/1  ----------------------------------------------------------------------
00397641   1/1  ----------------------------------------------------------------------
00385951   1/1  ----------------------------------------------------------------------
00469901   1/1  ----------------------------------------------------------------------
00380531   1/1  ----------------------------------------------------------------------
00452611   1/1  ----------------------------------------------------------------------
00456771   1/1  rlldrfg---------------------------------------------------------------
00476731   1/1  ----------------------------------------------------------------------
00429501   1/1  ----------------------------------------------------------------------
00429701   1/1  pll-------------------------------------------------------------------
00474481   1/1  ----------------------------------------------------------------------
00532191   1/1  ----------------------------------------------------------------------
00413581   1/1  ----------------------------------------------------------------------
00468071   1/1  ----------------------------------------------------------------------
00374181   1/1  ----------------------------------------------------------------------
00385821   1/1  ----------------------------------------------------------------------
00430021   1/1  Tlafdy----------------------------------------------------------------