[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66055.1


[Show Plain Result]

## Summary of Sequence Search
   1::377
 185::251  6.9e-15 37.3% 0053242 00532421 1/1   ke ribonucleoproteins                   
  97::184  8.8e-13 30.2% 0053244 00532442 2/2   nosensitive channel protein MscS (YggB) 
 252::355  2.5e-11 26.5% 0053243 00532431 1/1   nosensitive channel protein MscS (YggB) 
  18::88     0.038 19.0% 0053244 00532441 1/2   nosensitive channel protein MscS (YggB) 
   1::377


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEYLARLNIVAMLMSTTFWINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRLRPIVFEMLKK
00532421   1/1  ----------------------------------------------------------------------
00532442   2/2  ----------------------------------------------------------------------
00532431   1/1  ----------------------------------------------------------------------
00532441   1/2  -----------------yllkillallilliglllarlllrllrrlllkr........kldatllsllss


                         -         -         *         -         -         -         -:140
query           TSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQSWMRHLLYAPGSNKNPVTLVI
00532421   1/1  ----------------------------------------------------------------------
00532442   2/2  --------------------------yllkillallilliglllarlllrllrrlllkr..kldatllsl
00532431   1/1  ----------------------------------------------------------------------
00532441   1/2  llrylllvlalliaLsll----------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIALAVQTVLSDVFASLSIGFDKPFEIGDFVVF
00532421   1/1  --------------------------------------------dllsnliaglllllerpfrvGDlvev
00532442   2/2  lssllrylllvlalliaLsllGidltsllaglGalGlAiGlalq--------------------------
00532431   1/1  ----------------------------------------------------------------------
00532441   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NDVAGTIEHIGLKTTRIRSLSGEQIVCANAQLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMV
00532421   1/1  ggvlgtVeeiglrstvlrtldgelviiPnslllssvvtnls-----------------------------
00532442   2/2  ----------------------------------------------------------------------
00532431   1/1  -----------------------------------------sdplrrvdltvgvaydsdidkvkel...l
00532441   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KKIITDVGETQFDRAHLLAFGQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVV
00532421   1/1  ----------------------------------------------------------------------
00532442   2/2  ----------------------------------------------------------------------
00532431   1/1  levleehprvlkdpapvvgvtefgdsslnlevrfwvktl...dyldvksdlnlrikkaldeagieiPfPq
00532441   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RAPVQVEETRDYSNTADAKNADKRVMQ-------------------------------------------
00532421   1/1  ----------------------------------------------------------------------
00532442   2/2  ----------------------------------------------------------------------
00532431   1/1  rtvhl-----------------------------------------------------------------
00532441   1/2  ----------------------------------------------------------------------