[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66076.1


[Show Plain Result]

## Summary of Sequence Search
   1::294
  24::251  5.4e-71 33.5% 0042562 00425621 1/1   S ferredoxins                           
   2::245    4e-56 30.7% 0040210 00402101 1/1   S ferredoxins                           
  29::243  2.4e-54 33.7% 0038361 00383611 1/1   S ferredoxins                           
  27::233  5.9e-51 37.2% 0044015 00440151 1/1   S ferredoxins                           
  26::181  2.6e-31 37.4% 0038466 00384661 1/1   -helical ferredoxin                     
  93::200  1.3e-24 39.6% 0053368 00533682 2/2   S ferredoxins                           
  19::195  9.5e-23 27.5% 0052774 00527741 1/1   S ferredoxins                           
  29::194  1.4e-21 31.9% 0038470 00384701 1/1   S ferredoxins                           
  92::211  2.5e-21 33.6% 0039666 00396662 2/2   S ferredoxins                           
 115::214  1.4e-18 36.0% 0052779 00527792 2/2   S ferredoxins                           
  32::164  1.3e-17 37.1% 0052928 00529281 1/2   S ferredoxins                           
  19::183  5.4e-17 34.2% 0045859 00458591 1/1   S ferredoxins                           
  93::171  1.8e-15 33.8% 0035446 00354462 2/3   S ferredoxins                           
  29::163  3.2e-15 38.3% 0039142 00391421 1/2   S ferredoxins                           
  17::148  6.9e-15 30.9% 0048346 00483461 1/2   -helical ferredoxin                     
 128::206  1.4e-14 35.9% 0035614 00356142 2/2   S ferredoxins                           
  99::189  1.7e-14 37.2% 0047184 00471842 2/2   S ferredoxins                           
  88::189  1.8e-14 38.0% 0045037 00450372 2/2   S ferredoxins                           
  17::163  5.6e-14 29.6% 0047791 00477911 1/2   -helical ferredoxin                     
 126::206  7.8e-14 39.7% 0049159 00491592 2/2   S ferredoxins                           
 124::189  1.7e-13 36.9% 0043631 00436312 2/2   S ferredoxins                           
  93::169  1.5e-12 33.3% 0047149 00471492 2/3   S ferredoxins                           
 246::290  1.9e-12 42.9% 0040211 00402111 1/1   sulfur subunit of formate dehydrogenase 
 123::189  2.7e-12 32.8% 0046879 00468792 2/2   S ferredoxins                           
 124::202  2.6e-11 32.9% 0039453 00394532 2/2   S ferredoxins                           
  31::151  1.9e-10 39.5% 0052034 00520341 1/2   -helical ferredoxin                     
 119::188  1.1e-09 36.1% 0037513 00375132 2/2   S ferredoxins                           
 124::187  2.2e-09 32.2% 0044815 00448152 2/2   S ferredoxins                           
  93::152  7.6e-09 36.4% 0036609 00366092 2/3   S ferredoxins                           
  93::151  1.8e-08 38.2% 0046749 00467492 2/3   S ferredoxins                           
  93::151  2.9e-08 41.8% 0046170 00461702 2/3   S ferredoxins                           
 126::187  3.3e-08 35.8% 0046874 00468742 2/2   S ferredoxins                           
  93::151  3.9e-08 38.2% 0052658 00526582 2/3   S ferredoxins                           
  32::119  5.3e-08 32.1% 0035614 00356141 1/2   S ferredoxins                           
  33::115  1.4e-05 28.1% 0039453 00394531 1/2   S ferredoxins                           
  32::121  2.3e-05 36.8% 0049159 00491591 1/2   S ferredoxins                           
  14::114  0.00016 28.8% 0052779 00527791 1/2   S ferredoxins                           
  19::113  0.00063 21.3% 0037513 00375131 1/2   S ferredoxins                           
  32::120   0.0015 24.1% 0046874 00468741 1/2   S ferredoxins                           
  29::119   0.0026 24.6% 0046879 00468791 1/2   S ferredoxins                           
  30::120    0.008 25.4% 0044815 00448151 1/2   S ferredoxins                           
  33::123    0.014 30.5% 0043631 00436311 1/2   S ferredoxins                           
   6::49      0.15 25.0% 0047184 00471841 1/2   S ferredoxins                           
  31::49      0.31 42.1% 0039666 00396661 1/2   S ferredoxins                           
  32::49      0.97 33.3% 0035446 00354461 1/3   S ferredoxins                           
 174::199        1 30.8% 0039142 00391422 2/2   S ferredoxins                           
  32::49       1.4 38.9% 0047149 00471491 1/3   S ferredoxins                           
  32::49       1.7 33.3% 0053368 00533681 1/2   S ferredoxins                           
 157::192      1.7 41.7% 0048346 00483462 2/2   -helical ferredoxin                     
 174::192      1.9 47.4% 0052034 00520342 2/2   -helical ferredoxin                     
  32::49       3.5 38.9% 0036609 00366091 1/3   S ferredoxins                           
 174::192      3.6 47.4% 0047791 00477912 2/2   -helical ferredoxin                     
 174::187      4.4 50.0% 0046749 00467493 3/3   S ferredoxins                           
  32::49       4.8 44.4% 0046749 00467491 1/3   S ferredoxins                           
 174::187      5.5 50.0% 0046170 00461703 3/3   S ferredoxins                           
  32::49       5.9 44.4% 0046170 00461701 1/3   S ferredoxins                           
 174::187        6 50.0% 0052658 00526583 3/3   S ferredoxins                           
  32::49       6.6 44.4% 0052658 00526581 1/3   S ferredoxins                           
 174::195      6.9 40.9% 0035446 00354463 3/3   S ferredoxins                           
  34::49         7 50.0% 0045037 00450371 1/2   S ferredoxins                           
 174::186      7.3 61.5% 0052928 00529282 2/2   S ferredoxins                           
 174::188        9 46.7% 0036609 00366093 3/3   S ferredoxins                           
 174::190       21 41.2% 0047149 00471493 3/3   S ferredoxins                           
   1::294


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
00425621   1/1  -----------------------MkvkaqygmvidldkCigCgaCvvaCkeennlpvgveylwfnnvetk
00402101   1/1  -hlclegicggcgfcilacptgalddggsvkilidlskCigCgaCvaaCptelllpflpgklrgkilltl
00383611   1/1  ----------------------------qkgilidldkCigCgaCvvaCkeenilpalllarrvlellpa
00440151   1/1  --------------------------marygividlskCigcgaCevaCkdenllpvgltlalldellrp
00384661   1/1  -------------------------laaglgavididkclgcgacvvacpvel................n
00533682   2/2  ----------------------------------------------------------------------
00527741   1/1  ------------------dseevrkarklvlelllanhcldcgvCekagecel.................
00384701   1/1  ----------------------------rlgllvdllkctgCgaCgvacpveallpggll..........
00396662   2/2  ----------------------------------------------------------------------
00527792   2/2  ----------------------------------------------------------------------
00529281   1/2  -------------------------------fvillsvcigctacevacpvgailkd.............
00458591   1/1  ------------------llplekldilrpvividldkCigCgaCvavCpvgaitlvllg..........
00354462   2/3  ----------------------------------------------------------------------
00391421   1/2  ----------------------------rmrvvvdedkCigCgaCvaaC.....................
00483461   1/2  ----------------lappkellqspedrrklidldkCigCgaCvaaCPvyaitgde............
00356142   2/2  ----------------------------------------------------------------------
00471842   2/2  ----------------------------------------------------------------------
00450372   2/2  ----------------------------------------------------------------------
00477911   1/2  ----------------vtypleallsperfrplidldkCigCgaCvaaCPtgaitpd.............
00491592   2/2  ----------------------------------------------------------------------
00436312   2/2  ----------------------------------------------------------------------
00471492   2/3  ----------------------------------------------------------------------
00402111   1/1  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00394532   2/2  ----------------------------------------------------------------------
00520341   1/2  ------------------------------kilidldkCigCgaCvaaCPtgaitgd........flgpr
00375132   2/2  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00366092   2/3  ----------------------------------------------------------------------
00467492   2/3  ----------------------------------------------------------------------
00461702   2/3  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00526582   2/3  ----------------------------------------------------------------------
00356141   1/2  -------------------------------llidldkCigCgaCvlaCpvgaillvee...........
00394531   1/2  --------------------------------llvvidldkCigCglCvraCpvgaivlvell.......
00491591   1/2  -------------------------------vlidldkCigCgaCvlaC.....................
00527791   1/2  -------------cPlgalvlldngrgdislpivvidedkCigCgaCvaaC...................
00375131   1/2  ------------------lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllr.......
00468741   1/2  -------------------------------vvvdedkCigcglCvlvCpvgailld.............
00468791   1/2  ----------------------------lglvvvdedkCigcglCvlacpdaivldddglvvvlle....
00448151   1/2  -----------------------------lkvvvdedkCigcglCvlvCpvgailld.............
00436311   1/2  --------------------------------lglvvvdedkCigcglCvlacPvgaill..........
00471841   1/2  -----lllllllalcplvcplgalpllslglvvidedkCigCglCvaaC---------------------
00396661   1/2  ------------------------------vavidedkCigCghcedaa---------------------
00354461   1/3  -------------------------------avvdldkCigCglapCva---------------------
00391422   2/2  ----------------------------------------------------------------------
00471491   1/3  -------------------------------ividldkCigCedglCve---------------------
00533681   1/2  -------------------------------ivvdpdkCigCglapCve---------------------
00483462   2/2  ----------------------------------------------------------------------
00520342   2/2  ----------------------------------------------------------------------
00366091   1/3  -------------------------------llvdlelCigcglCvevC---------------------
00477912   2/2  ----------------------------------------------------------------------
00467493   3/3  ----------------------------------------------------------------------
00467491   1/3  -------------------------------llidldlCigcglCvkvC---------------------
00461703   3/3  ----------------------------------------------------------------------
00461701   1/3  -------------------------------llidldlCigcglCvkvC---------------------
00526583   3/3  ----------------------------------------------------------------------
00526581   1/3  -------------------------------llidldlCigcglCvkvC---------------------
00354463   3/3  ----------------------------------------------------------------------
00450371   1/2  ---------------------------------idlekCigCgaCvevC---------------------
00529282   2/2  ----------------------------------------------------------------------
00366093   3/3  ----------------------------------------------------------------------
00471493   3/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
00425621   1/1  Pglgyprgaedleklkggwvlkfdgellpalggilagllnicpnphlpdiddyyepftydylvlfgapvg
00402101   1/1  aglgaaigrvdlsdigtypkpgpviepdrCihCgdppCvkaCPtgAiskdpedgivvidedrCigCgaCv
00383611   1/1  allplaallvlllelgvvgkvlalflpvlCvhCgdpaCvavCPt.gaillvlkdeedgivlidpdlskCi
00440151   1/1  ......llpvkflekgvvppllalylpvlCihCedppCv.vCPt.gAiykdedgivlidpdkCigCgyCv
00384661   1/1  lpvgkllgrlyvprievpeldpeerlkdfdevlllglgeeealrealrCihCgdppCvkvCPt.gaiipe
00533682   2/2  ----------------------ivvdpdkCigCglapCvevCp.vgaiyl.edgivvidpdkCigCglCv
00527741   1/1  ...........qdlavllgvlksrfvpekcrhcg..pcvlvcPvgaivlvddsgglivideekCigCgrC
00384701   1/1  ......pacgpyveagalgetivlflpllcllc..gpcvlvCptgaiagicelaellglallplgllgll
00396662   2/2  ---------------------vavidedkCigCghcedaaCvevCP.vgaitldedgllivvidpdkCig
00527792   2/2  --------------------------------------------cPlgalvlldngrgdislpivvided
00529281   1/2  ......................glividaelcigcgpCvrvCPa.gaieivedggglllrvvinaenCig
00458591   1/1  ..........................pracilc..pacvkvcptgallklegggrvvidldkCigCglCv
00354462   2/3  ----------------------avvdldkCigCglapCvavCp.vgaill.edgivvidpdlCigcglCv
00391421   1/2  ..........................pvgaivlddglcvrvcptg.......dgivvidpdlcigcgaCv
00483461   1/2  ..........................flgprglicalrlladprdaltkerledliveidldrCigCgaC
00356142   2/2  ---------------------------------------------------------llidldkCigCga
00471842   2/2  ----------------------------lllllllalcplvcplgalp.llslglvvidedkCigCglCv
00450372   2/2  -----------------llllllalllllcgccgdcvcayacp.tgailgrergivvidedkCigCglCv
00477911   1/2  ..........................flgprglicalcllacprdaltkerledllvvidldrCigCgaC
00491592   2/2  -------------------------------------------------------vlidldkCigCgaCv
00436312   2/2  -----------------------------------------------------lglvvvdedkCigcglC
00471492   2/3  ----------------------ividldkCigCedglCvevCp.vgaivl.edglvvidpdlCigCglCv
00402111   1/1  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------lglvvvdedkCigcglCv
00394532   2/2  -----------------------------------------------------llvvidldkCigCglCv
00520341   1/2  .............................cllc..aacllacpr.gaitleerledglvvidldrCigCg
00375132   2/2  ------------------------------------------------lgaklkldlllglvvidedkCi
00448152   2/2  -----------------------------------------------------lkvvvdedkCigcglCv
00366092   2/3  ----------------------llvdlelCigcgl..CvevCpv.gaill..dglvlidldlcigcglCv
00467492   2/3  ----------------------llidldlCigcgl..CvkvCp..vgaillldglvvidldlCigcglCv
00461702   2/3  ----------------------llidldlCigcgl..CvkvCp.vgaill.ldglvvidldlCigcglCv
00468742   2/2  -------------------------------------------------------vvvdedkCigcglCv
00526582   2/3  ----------------------llidldlCigcgl..CvkvCp..vgaillldglvvidldlCigcglCv
00356141   1/2  .....................llvidpdlCigclgkgeegaCvevCPtg---------------------
00394531   1/2  .................glllllllvvidpdlCigC..gaCvevC-------------------------
00491591   1/2  .....pvgaillgde......llvidpdkCigCgdrglepaCvevCPv.ga-------------------
00527791   1/2  PtgaitgdealdprgriieldgkvplrfridpdkCigC..gaCv--------------------------
00375131   1/2  ...........gllllvglklvvvidlekCigC..gaCvevCP---------------------------
00468741   1/2  ................dgllvvlvidldlcigc..glCvevCPvgAisle--------------------
00468791   1/2  ........................vdldlcigcga..CvevCPvgAisl---------------------
00448151   1/2  .................dgllllvvdldlcigc..glCvevCPvgAisle--------------------
00436311   1/2  ................ddggvavkltlvvdedlcigc..gaCvevCPv.gAit-----------------
00471841   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/3  ----------------------------------------------------------------------
00391422   2/2  ----------------------------------------------------------------------
00471491   1/3  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00483462   2/2  ----------------------------------------------------------------------
00520342   2/2  ----------------------------------------------------------------------
00366091   1/3  ----------------------------------------------------------------------
00477912   2/2  ----------------------------------------------------------------------
00467493   3/3  ----------------------------------------------------------------------
00467491   1/3  ----------------------------------------------------------------------
00461703   3/3  ----------------------------------------------------------------------
00461701   1/3  ----------------------------------------------------------------------
00526583   3/3  ----------------------------------------------------------------------
00526581   1/3  ----------------------------------------------------------------------
00354463   3/3  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00529282   2/2  ----------------------------------------------------------------------
00366093   3/3  ----------------------------------------------------------------------
00471493   3/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEH
00425621   1/1  cklcptacpvslitgkplfkieagpnwdddlggslvlaprdpnltrvrllevgefpkpfpvydpelCihC
00402101   1/1  rvCPvgaitidpetvdaekCigCgdrldegllPaCveaCptgaikfgpleelisevrelllelkerllel
00383611   1/1  gCgyCvaaCPygaivinpetgvaekCtlCgdrleegllPaCveaCptgaivfgdledlaslvskllallp
00440151   1/1  laCPygairlneetgvaekCtlCldrlatillggkaPaCveaCptgallfgdledllaeakklle.....
00384661   1/1  liglvyegdigealelllstnplplvdgrvCigCglCeeaC-----------------------------
00533682   2/2  avCPvgaitlepelglaekcllclnrelcggcpacveacptgaltfgllddllklvilll----------
00527741   1/1  vraCpevaitlvlglagrgldtrigtvidaskCvlC.........gaCvevCPtg---------------
00384701   1/1  gdlslgvvvidedkCigCglCvraCPvgaislveldpe.gkvvidpdkCtgC..----------------
00396662   2/2  CglCvevCPtgAidivplleeareellelylelvealllllelgggllkgllcvlrlecilcpacveacp
00527792   2/2  kCigCgaCvaaCPtgaitgdealdprgriieldgkvplrfridpdkCigC.........gaCvevCPtgA
00529281   1/2  CgtCviaCPtgaislvppeggvgp----------------------------------------------
00458591   1/1  evCPvgaiilelile.lrkcilc.........gacveaCptgA---------------------------
00354462   2/3  evCPvgaillellllllekcllcgacvlacp---------------------------------------
00391421   1/2  aaCPvgaitleeetglalkcdlc-----------------------------------------------
00483461   1/2  vevCPvgi--------------------------------------------------------------
00356142   2/2  CvlaCpvgaillvee.llvidpdlCigclgkgeegaCvevCPtgAivlgdllellllellelllel----
00471842   2/2  aaCpvgaivlelekglvvidlekCigC.........gaCvevCptgait---------------------
00450372   2/2  aaCPvgaisldglglerlvlllklvidlekCigC.........gaCvev---------------------
00477911   1/2  vevCPvgailvdlirelrrelve-----------------------------------------------
00491592   2/2  laCpvgaillgdellvidpdkCigCgdr...glepaCvevCPvgaillgdllelllelllllllll----
00436312   2/2  vlacPvgailldd.ggvavkltlvvdedlcigcgaCvevCPvgAitlve---------------------
00471492   2/3  lvCPvgaillkllllllllllldllldll-----------------------------------------
00402111   1/1  ----------------------------------------------------------------------
00468792   2/2  lacp.daivldddglvvvllevdldlcig..cgaCvevCPvgAisleee---------------------
00394532   2/2  raCpvgaivlvellglllllllvvidpdlCigC.........gaCvevCPtgaitlvdllel--------
00520341   1/2  aCvevCPvgai-----------------------------------------------------------
00375132   2/2  gCgrCvraCpvgaitlvlllllrgllllvglklvvvidlekCigC...----------------------
00448152   2/2  lvCpvgaillddgllllv.....vdldlcigcglCvevCPvgAisle-----------------------
00366092   2/3  lvCPvgailled----------------------------------------------------------
00467492   2/3  lvCPvgaille-----------------------------------------------------------
00461702   2/3  lvCPvgaille-----------------------------------------------------------
00468742   2/2  lvCpvgaillddgllvvlvidldlcigc.........glCvevCPvg-----------------------
00526582   2/3  lvCPvgaille-----------------------------------------------------------
00356141   1/2  ----------------------------------------------------------------------
00394531   1/2  ----------------------------------------------------------------------
00491591   1/2  ----------------------------------------------------------------------
00527791   1/2  ----------------------------------------------------------------------
00375131   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------
00436311   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/3  ----------------------------------------------------------------------
00391422   2/2  ---------------------------------aCvaaCPvgaitleeetglalkcdlc-----------
00471491   1/3  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00483462   2/2  ----------------ldrCigC.........gaCvevCPvgiilvdliael------------------
00520342   2/2  ---------------------------------aCvevCPvgailvdlirel------------------
00366091   1/3  ----------------------------------------------------------------------
00477912   2/2  ---------------------------------aCvevCPvgailvdlirel------------------
00467493   3/3  ---------------------------------lCvlvCPvgaille-----------------------
00467491   1/3  ----------------------------------------------------------------------
00461703   3/3  ---------------------------------lCvlvCPvgaille-----------------------
00461701   1/3  ----------------------------------------------------------------------
00526583   3/3  ---------------------------------lCvlvCPvgaille-----------------------
00526581   1/3  ----------------------------------------------------------------------
00354463   3/3  ---------------------------------lCvevCPvgaillellllllek---------------
00450371   1/2  ----------------------------------------------------------------------
00529282   2/2  ---------------------------------tCviaCPtgaisl------------------------
00366093   3/3  ---------------------------------lCvlvCPvgailled----------------------
00471493   3/3  ---------------------------------lCvlvCPvgaillklll--------------------


                         -         -         -         +         -         -         -:280
query           AGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
00425621   1/1  gdppCvevCPt.gAiykdpedgivvidpdkCigCglCvaaC-----------------------------
00402101   1/1  lllllpelgglpgvlylaplvllvtlllglplkpl-----------------------------------
00383611   1/1  el......llllgllfglglvllpllgtkplvl-------------------------------------
00440151   1/1  ...lllvllpelgtgpevlylll-----------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00533682   2/2  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00396662   2/2  v---------------------------------------------------------------------
00527792   2/2  itlv------------------------------------------------------------------
00529281   1/2  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00354462   2/3  ----------------------------------------------------------------------
00391421   1/2  ----------------------------------------------------------------------
00483461   1/2  ----------------------------------------------------------------------
00356142   2/2  ----------------------------------------------------------------------
00471842   2/2  ----------------------------------------------------------------------
00450372   2/2  ----------------------------------------------------------------------
00477911   1/2  ----------------------------------------------------------------------
00491592   2/2  ----------------------------------------------------------------------
00436312   2/2  ----------------------------------------------------------------------
00471492   2/3  ----------------------------------------------------------------------
00402111   1/1  -----------------------------------isllvklWkGvlkplgllallatllaallhyvtvG
00468792   2/2  ----------------------------------------------------------------------
00394532   2/2  ----------------------------------------------------------------------
00520341   1/2  ----------------------------------------------------------------------
00375132   2/2  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00366092   2/3  ----------------------------------------------------------------------
00467492   2/3  ----------------------------------------------------------------------
00461702   2/3  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00526582   2/3  ----------------------------------------------------------------------
00356141   1/2  ----------------------------------------------------------------------
00394531   1/2  ----------------------------------------------------------------------
00491591   1/2  ----------------------------------------------------------------------
00527791   1/2  ----------------------------------------------------------------------
00375131   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------
00436311   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/3  ----------------------------------------------------------------------
00391422   2/2  ----------------------------------------------------------------------
00471491   1/3  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00483462   2/2  ----------------------------------------------------------------------
00520342   2/2  ----------------------------------------------------------------------
00366091   1/3  ----------------------------------------------------------------------
00477912   2/2  ----------------------------------------------------------------------
00467493   3/3  ----------------------------------------------------------------------
00467491   1/3  ----------------------------------------------------------------------
00461703   3/3  ----------------------------------------------------------------------
00461701   1/3  ----------------------------------------------------------------------
00526583   3/3  ----------------------------------------------------------------------
00526581   1/3  ----------------------------------------------------------------------
00354463   3/3  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00529282   2/2  ----------------------------------------------------------------------
00366093   3/3  ----------------------------------------------------------------------
00471493   3/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PNKETDDDEEDHHE--------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00533682   2/2  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00396662   2/2  ----------------------------------------------------------------------
00527792   2/2  ----------------------------------------------------------------------
00529281   1/2  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00354462   2/3  ----------------------------------------------------------------------
00391421   1/2  ----------------------------------------------------------------------
00483461   1/2  ----------------------------------------------------------------------
00356142   2/2  ----------------------------------------------------------------------
00471842   2/2  ----------------------------------------------------------------------
00450372   2/2  ----------------------------------------------------------------------
00477911   1/2  ----------------------------------------------------------------------
00491592   2/2  ----------------------------------------------------------------------
00436312   2/2  ----------------------------------------------------------------------
00471492   2/3  ----------------------------------------------------------------------
00402111   1/1  pneveeeeee------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00394532   2/2  ----------------------------------------------------------------------
00520341   1/2  ----------------------------------------------------------------------
00375132   2/2  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00366092   2/3  ----------------------------------------------------------------------
00467492   2/3  ----------------------------------------------------------------------
00461702   2/3  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00526582   2/3  ----------------------------------------------------------------------
00356141   1/2  ----------------------------------------------------------------------
00394531   1/2  ----------------------------------------------------------------------
00491591   1/2  ----------------------------------------------------------------------
00527791   1/2  ----------------------------------------------------------------------
00375131   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------
00436311   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/3  ----------------------------------------------------------------------
00391422   2/2  ----------------------------------------------------------------------
00471491   1/3  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00483462   2/2  ----------------------------------------------------------------------
00520342   2/2  ----------------------------------------------------------------------
00366091   1/3  ----------------------------------------------------------------------
00477912   2/2  ----------------------------------------------------------------------
00467493   3/3  ----------------------------------------------------------------------
00467491   1/3  ----------------------------------------------------------------------
00461703   3/3  ----------------------------------------------------------------------
00461701   1/3  ----------------------------------------------------------------------
00526583   3/3  ----------------------------------------------------------------------
00526581   1/3  ----------------------------------------------------------------------
00354463   3/3  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00529282   2/2  ----------------------------------------------------------------------
00366093   3/3  ----------------------------------------------------------------------
00471493   3/3  ----------------------------------------------------------------------