[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66209.1


[Show Plain Result]

## Summary of Sequence Search
   1::71
   1::67   3.8e-19 38.8% 0052816 00528161 1/1   like                                    
   8::67   4.5e-12 35.6% 0052131 00521311 1/1   like                                    
   1::71


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAK
00528161   1/1  lselpllllaladssmdlddiveqldqlvddlneevekalealetnpsdPelllklqfalseyslfi---
00521311   1/1  -------eegvdalnkelsealekle.snpndPelllelqfalqeyslflnlqssvvkalkDllsgI---


                         -         -         *         -         -         -         -:140
query           I---------------------------------------------------------------------
00528161   1/1  ----------------------------------------------------------------------
00521311   1/1  ----------------------------------------------------------------------