[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66348.1


[Show Plain Result]

## Summary of Sequence Search
   1::339
   1::170  6.3e-57 42.9% 0042365 00423651 1/1   -like                                   
   1::171  1.2e-55 40.9% 0046449 00464491 1/1   -like                                   
   1::337  1.5e-54 46.4% 0046113 00461131 1/1   -like                                   
   1::169  2.3e-54 41.4% 0040817 00408171 1/1   -like                                   
   1::168  7.3e-54 44.6% 0043275 00432751 1/1   -like                                   
   1::168    3e-53 41.1% 0039779 00397791 1/1   -like                                   
   1::178    3e-53 41.3% 0047654 00476541 1/1   -like                                   
   1::194  4.3e-52 40.5% 0047994 00479941 1/1   -like                                   
   2::167  5.8e-51 40.0% 0047104 00471041 1/1   -like                                   
   1::177  1.1e-50 42.5% 0048672 00486721 1/1   -like                                   
   1::169  8.9e-50 42.3% 0048862 00488621 1/1   -like                                   
   1::197  2.7e-49 45.6% 0046724 00467241 1/1   -like                                   
   1::192  8.8e-49 33.7% 0047232 00472321 1/1   -like                                   
   1::152  2.8e-46 46.1% 0050001 00500011 1/1   -like                                   
   1::169  4.1e-46 42.6% 0050202 00502021 1/1   -like                                   
   1::191  8.5e-46 31.4% 0047181 00471811 1/1   -like                                   
   1::192  9.2e-46 30.7% 0046252 00462521 1/1   -like                                   
   1::143  2.7e-45 39.4% 0046314 00463141 1/1   -like                                   
   1::185    9e-45 34.6% 0047846 00478461 1/1   -like                                   
   1::182  3.3e-43 33.5% 0045092 00450921 1/1   -like                                   
   1::192  2.2e-41 32.1% 0047235 00472351 1/1   -like                                   
   1::167  1.1e-39 34.8% 0042905 00429051 1/1   -like                                   
   1::168  5.9e-39 36.8% 0050889 00508891 1/1   -like                                   
   1::170  4.4e-37 42.9% 0049685 00496851 1/1   -like                                   
   1::170  6.3e-36 38.1% 0051263 00512631 1/1   -like                                   
   1::168  9.7e-32 37.5% 0047480 00474801 1/1   -like                                   
   1::179  1.4e-26 36.0% 0038267 00382671 1/1   -like                                   
   4::180  4.3e-26 26.1% 0036743 00367431 1/2   -like                                   
   1::143  1.1e-24 35.8% 0041738 00417381 1/1   -like                                   
 134::302  4.4e-24 28.6% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
 135::306  4.1e-23 29.2% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
 131::300  6.3e-23 29.7% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
 135::300  4.7e-22 28.7% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
 131::300  5.8e-22 26.7% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
 135::299  4.2e-21 27.4% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
 135::300  2.1e-20 28.7% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
 135::309  6.2e-20 26.8% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
 135::301    1e-19 29.5% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
 134::302    8e-18 27.3% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
 135::304  1.7e-17 24.7% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 131::299  3.1e-17 26.8% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
 134::302  1.1e-15 25.1% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
 143::301  1.2e-15 25.5% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
 135::302  1.5e-15 23.4% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
 145::285  1.9e-15 31.4% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
 140::316    6e-15 25.3% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
 132::299  2.9e-14 21.1% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 145::264    1e-13 31.1% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
 131::327  4.9e-12 22.2% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
 133::299  2.9e-11 23.8% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
 156::284  2.9e-11 26.2% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
 140::287  7.7e-09 22.6% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
 133::333    3e-08 22.0% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
 128::260  3.1e-08 26.2% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
 164::259  3.2e-07 30.1% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
 133::263    9e-07 23.8% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
 142::228  1.1e-06 21.8% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
 131::301  1.5e-06 19.3% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
 140::262  5.5e-06 23.3% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
 136::275  8.9e-06 20.3% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  72::276  1.1e-05 18.0% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
 144::270  1.3e-05 18.2% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
  83::323  1.5e-05 18.3% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
 139::260    2e-05 21.6% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   2::138  3.2e-05 32.7% 0044605 00446051 1/1   -like                                   
 136::224  4.7e-05 23.9% 0047847 00478471 1/1   )-binding Rossmann-fold domains         
 138::259  7.2e-05 22.9% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 143::201  0.00026 28.8% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
 164::228  0.00039 32.3% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
 160::278  0.00084 23.2% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 284::335     0.23 26.9% 0036743 00367432 2/2   -like                                   
   1::339


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
00423651   1/1  aaalpltmkalvltgpgpleleevpvpepgpgevlvkvlatgicgtDlhilkgglplalvlklplvlGhE
00464491   1/1  kmkAlvllgpgdlrleevpvpepgpgevlvkvaatgiCgsDlhlykhgdlgdllvklPlvlGHEiaGvVv
00461131   1/1  lllslpltmkaavltgpggpleleevpvpepgpgevlvkvlaagicgsDllhirrglyp.lplPlvlGhE
00408171   1/1  lslvitmkAavltgpggpleleevpvpepgpgeVlvkvlaagicgtDlhilrglyplvklplvlGhEaaG
00432751   1/1  mkAlvltgpgdpleleevpvpepgpgevlvkvlaagicgtDlhiyrgglpllvklplvlGhEaaGvVvev
00397791   1/1  mkAavltgpgdpleleevpvpepgpgeVlvkvlaagicgsDlhilrglyplllllllllvklplvlGhEa
00476541   1/1  MkalvltgpgdleleevplpepgpgevlvkvlaagingsDlhlirlglyplll.plvlGhEaaGvVvevG
00479941   1/1  smpltmkalvltgpgdpleleevplpepgpgevlvkvlaagingsDlhillglyplplklplvlGhEgaG
00471041   1/1  -kAavllgpgdplrledvpvpelpgpgevlvkvaaagiCgtDlhilegllpglllvklPlvlGhEiaGvv
00486721   1/1  mtlslpltmkalvltgpgdpleleevpvpepgpgeVlvkvlaagicgsDlhilrglypvp.lplvlGhEg
00488621   1/1  ltlsllmkamkalvlggpgpleleevpvpepgpgevlvkvlaagingsDlhirrglypvpklplvlGhEa
00467241   1/1  mstmkalvltgpgdpleleevpvpepgpgeVlvkvlaagingsDlhilrglypv.plplvlGhEgaGvVv
00472321   1/1  stagkvikmkAavlrgagkpleieevelpepgpgeVlvkvvatGiCgtDlhvldgllp.vplPlvlGHEg
00500011   1/1  mkaavvlggpgpleleevplpepgpgevlvkvlaagicgsDlhilrglypllklplvlGhEaaGvVvavG
00502021   1/1  lpltmkalvltgpgdpleleevpvpepgpgeVlvkvlaagingsDlhirrglypvlplplvlGhEgaGvV
00471811   1/1  stlgkvikmkAavlrgpgkpleieevelpepgpgeVlvkvvatGiChsDlhvldgllpvp.lPvvlGHEg
00462521   1/1  stagkvikmkAavlrepgkpleieevelpepgpgeVlvkvvatGvChtDlhvldgalpvp.lPvvlGhEg
00463141   1/1  stagkvikmkAavlreagkpleieevelpepgpgevlvkvvatGiChtDlhvldgalp.vplPlvlGHEg
00478461   1/1  tmkavvylgpgkveveevplPelegpggkklegdvivkvtatgiCgsDlhilrgllp.velplvlGHEfv
00450921   1/1  mkallllglgklellevpePepgPgevlvrtlavgvcgtDlhvldgdlpgvelgiilGheivGeVvevGs
00472351   1/1  stagkvikmkAavllgpgkpleieevelpepgpgeVlvkvvatGiChsDlhvldgelp.vplPlvlGHEg
00429051   1/1  mkAlvlygagdpevlrleevplpepgpgevlvkvkavgingtDlkilsggypvlklplilGhEaaGvVee
00508891   1/1  petmkalvltgpggpevleleevplpepgpgevlvkvlaaglnpsDllillglyplvlplplvlgheaaG
00496851   1/1  sktmkalvltgpgdpevleleevplpepgpgevlvkvlaaglnpsDllilrglyplvvplplvlGhegaG
00512631   1/1  etmkalvltgpggpevlelelevplpepgpgevlvkvlaaglnpsDllilsglyplvpplplvlghegaG
00474801   1/1  mkalvltgpgdpleleevplpepgpgevlvkvlaaglngsDllillglyplllelplvlGhEaaGvVv..
00382671   1/1  lilmkAvvvlatgdPkevlflkveeiplpalgpgevlvkviaagicgtDlailqgvyptkpvktignptg
00367431   1/2  ---atagkvikckAavlweagkplvieevevapPkagevlvkivatglChtdlhvlsgalp.llfPvilG
00417381   1/1  mkalvldelggpevlelvelplpelgpgevlvkvhaaglnykDllartglypvvpglplvpGlefaGvvv
00462531   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00481071   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00486731   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00500401   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00446051   1/1  -mvtnkqivlakrpegfPkpedfeleevplpepgdgevlvkvlylsv...DPymrgrmypvelgevmvgg
00478471   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00367432   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
00423651   1/1  avGvVvevGsgvtglkvGdrVvvlpllscgecpyclagrynlcegllflgvlgldGgfaeyvvvpaanlv
00464491   1/1  evGsgvtglkvGdrVvveplvscgeceycrrgrynlcenllflglppldGgfaeyvvvpaallvklPdgl
00461131   1/1  gaGvVvevGsgvtgfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldgtlrlllggksll
00408171   1/1  vVvevGsgvtgfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlrlslgglllggvl
00432751   1/1  GsgvtglkvGdrVvvlplliscgecryclsglpnlcenllflgvlldGgfaeyvvvpaanlvklpdglsl
00397791   1/1  aGvVvevGsgvtgfkvGdrVvvlpllscgecraclsglenlcenllflgllldggfaeyvvvpaallvkl
00476541   1/1  sgvtgfkvGdrVvvlpvlscgeceaclsglenlcenllfglllgllldGgfaeyvvvplaadllvklPld
00479941   1/1  vVvevGsgvtgfkvGdrVvvlplvgscgeceaclsglenlcenllllgllldGgfaeyvvvpadllvklP
00471041   1/1  eevGegvtglkvGdrvvvllllscgtCraCraglenlCenllllGllldGgfaeyvvvparllvklpdgl
00486721   1/1  aGvVvevGsgvtgfkvGDrVvvlflvscgeceaclsglenlcenl.vlglggglllggttrlllggkpll
00488621   1/1  aGvVvevGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllgltldGgfaeyvv
00467241   1/1  evGsgvtgfkvGDrVvglf.iscgeceaclaglenlcenllllglggdlldgtlllsllglslllglllg
00472321   1/1  aGiVeevGegVtdlkpGDrVvllfiisCgeCryCrsglenlCenlgvllllgvlldgtlafy..vdgkll
00500011   1/1  sgvtglkvGdrVvvlplviscgeceacrsglenlcenllllglagllllgllldGgfaeyvvvparnlvk
00502021   1/1  vevlGsgvtgdlslfkvGdrVvglpviscgeceacllsglenlcpnllllglngglllgllldGgfaeyv
00471811   1/1  aGvVeevGegVtgvkvGDrVvllflpscgeCryClsglenlCenlgalnlggvlpggtaeltv.dgklll
00462521   1/1  aGvveevGegVtgvkpGdrVvllfllscgeCryClsgrenlCenlglngvgllgdgterftadgkllghf
00463141   1/1  aGiVeevGegVtdlkvGdrVvllfllsCgeCryCrsglenlCenlgvlvllgvlldgtlrfylvggpvlh
00478461   1/1  GeVvevGsdvtnlkvGdrVvvpflisCgeCryCkagltslCenlnlglagallGyldlggldGgqAeyvr
00450921   1/1  nveglkvGdrVvvpallscgtclycrrgllnlcddlllgellglgrdGafaeyvlvpaadaflvklPdel
00472351   1/1  aGiVeevGegVtglkvGdrVvllflisCgeCryClsglenlCenlralgllgvlgggaerllvdgkvllh
00429051   1/1  vGsgvtglkvGDrVvvll...cg.......................dgglaeyvvvdedllvklPeslsl
00508891   1/1  vVvevgsg..gfkvGdrVvvlllv.....................lgllldGgfaeyvvvpadllvklPd
00496851   1/1  vVvevgsg..gfkvGdrVvvlplv.....................lgllrdGgfaeyvvvpadllvklPd
00512631   1/1  vVvevGsgvtgfkvGdrVvvllll..........................dggfaeyvvvpadllvklpd
00474801   1/1  .........GdrVvvll...........................ldggfaeyvvvpadllvklPdglsle
00382671   1/1  elpvvlGhEavgvViavGsnVsslkpGDrV....vpivvs......................dgalaeya
00367431   1/2  HegaGivesvGegvtsvkpGdhvvllflpeCgeCklClsgktnlCeklrllglallgkgllldgtsrfsl
00417381   1/1  avgeg..gfkvGdrVvalgl.....................glgetldGglaeyvvvpadllvplPdgls
00462531   1/1  ---------------------------------------------------------------glsleea
00502031   1/1  ----------------------------------------------------------------lsleea
00481071   1/1  ------------------------------------------------------------lple...eaa
00467251   1/1  ----------------------------------------------------------------lsleea
00461141   1/1  ------------------------------------------------------------lple...eaa
00513271   1/1  ----------------------------------------------------------------lsleea
00486731   1/1  ----------------------------------------------------------------pleeaa
00474811   1/1  ----------------------------------------------------------------lsleea
00476551   1/1  ----------------------------------------------------------------lsleea
00488631   1/1  ---------------------------------------------------------------lsleeaA
00512641   1/1  ----------------------------------------------------------------lsleea
00405511   1/1  ------------------------------------------------------------lsle...eaa
00432761   1/1  ---------------------------------------------------------------lplelaa
00367461   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------lplelg
00397801   1/1  ----------------------------------------------------------------------
00487991   1/1  ---------------------------------------------------------------------e
00383791   1/1  -------------------------------------------------------------pkdvdlrvl
00387111   1/1  ----------------------------------------------------------------------
00385671   1/1  ------------------------------------------------------------lplellallG
00502041   1/1  --------------------------------------------------------------lsleeaaa
00429061   1/1  ----------------------------------------------------------------------
00367441   1/1  ---------------------------------------------------------------------l
00485161   1/1  --------------------------------------------------------------lsleeaAa
00374371   1/1  ---------------------------------------------------------agrlavleaalll
00484541   1/1  ----------------------------------------------------------------------
00508901   1/1  --------------------------------------------------------------lsleeaAa
00472761   1/1  ----------------------------------------------------------------------
00445261   1/1  ------------------------------------------------------------pkslpllela
00500401   1/1  ---------------------------------------------------------------------g
00484901   1/1  -----------------------------------------------------------------lllld
00473291   1/1  -vkllkegdrvllelgrplmllellregglldtrlgiepledllgvprglfldlavgylvlilrpltedl
00484691   1/1  ----------------------------------------------------------------------
00475801   1/1  ------------medleearkklvelllrnngilnlrvldalervprehfvpsllgylafldlplafgeg
00423401   1/1  --------------------------------------------------------------------aG
00446051   1/1  ...gvgevvesgvpgfkvGdlVvgl..............................ggwaeyavvdadl--
00478471   1/1  -----------------------------------------------------------------iedll
00496861   1/1  -------------------------------------------------------------------Aas
00472781   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00367432   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
00423651   1/1  klpdglsleeaalleplavtahaalragll----------------------------------------
00464491   1/1  slelaalleplllatalhavelaglklgdtv---------------------------------------
00461131   1/1  tldGlsgfaeyvvvparllvkilPdglslee.......................................
00408171   1/1  ldggfaeyvvvparllvklpdglsleeaa-----------------------------------------
00432751   1/1  elaalleplavtahaallagvlpgdtvl------------------------------------------
00397791   1/1  pdglsleeaallepalltalhallragl------------------------------------------
00476541   1/1  glslee..llcagltayllllalleraglkpgdtvl..--------------------------------
00479941   1/1  dg..........................gdtvlvlgaalllllllllllllsll----------------
00471041   1/1  ldleeaalllealltalhavlragv.l-------------------------------------------
00486721   1/1  gflgdGgfaeyvvvpernlvkidPdglsleeaalllc---------------------------------
00488621   1/1  vpadllvklPdglsleeaallpca.tayh-----------------------------------------
00467241   1/1  lGgfaeyvvvpadllvkllPdglsleea.............................-------------
00472321   1/1  ghllgqssfaeyavvdelsvvkv.dllkddlplllaallglgviglgavll.------------------
00500011   1/1  lPdglsleeaal----------------------------------------------------------
00502021   1/1  vvdpadllvklPdglllellsleeAlaAl-----------------------------------------
00471811   1/1  hflggssfaeyavveeas.vvkvdadlpllkagllgvlvlggigaalnllk-------------------
00462521   1/1  lglssfaeyavvdevs.vvkvddlkldlpllivallgcgvitglgallnkgk------------------
00463141   1/1  flg-------------------------------------------------------------------
00478461   1/1  vpladvlllklPdglsldealllladvlptgllalagaklg..ll-------------------------
00450921   1/1  ddeaaalleplsvtalrslvkrlavtpakavlvlGaGaigll----------------------------
00472351   1/1  llglssfaeyavvsealv....vkvddllpldlvlllgcgvltgigaalnll------------------
00429051   1/1  levleaaallvalltaysalrraglkp-------------------------------------------
00508891   1/1  g.sleeaaavlplaglylallralggll------------------------------------------
00496851   1/1  glsleeaa.....................V----------------------------------------
00512631   1/1  gllsleeaaalpl.........agllkpge----------------------------------------
00474801   1/1  eaaalplalgltaylallelaglkp..v------------------------------------------
00382671   1/1  vvdenaliklpdel...aalltlaaltalkaireletly-------------------------------
00367431   1/2  kgkpvlhflglstFaeytvvdeisvvkidddaplekvall------------------------------
00417381   1/1  lee-------------------------------------------------------------------
00462531   1/1  alllcalltayhalvrragvkpgdtVlvlGaGgvGllavqlAk.alGasrViavdlseeklelakelGad
00502031   1/1  AalpeagltayhalveraglkpgdtVlvlGaGgvGllavqlaka.lGasrViatdrspeklelakelGad
00481071   1/1  allcplltayhallrragvkpgdtVlvlGaGgvGllavqlAk.alGasrviavdlsdeklelakelGadh
00467251   1/1  aallealltayhalvrragvkpgdtVlvlGaGgvGllaiqlAk.algasrViavdlseeklelakelGad
00461141   1/1  allcalatayhalvrragvkpgdtVlvlGaGgvGllavqlAk.algasrviavdlspeklelakelGadh
00513271   1/1  AalpealltayhalvraglkpgdtVlviGaGgvGllaiqlaka.lGagrViatdispeklelakelGadh
00486731   1/1  allcalltayhalvrragvkpgdtVlvlGaGgvGllavqlAkal.GasrViavdlseeklelakelGade
00474811   1/1  AalplagltAylalvraglkpgdtVlvtGAaGgvGlaavqlakalGa..rViatdrspeklelakelGad
00476551   1/1  aalpeplltayhalrlagvkpgdtVlvlGaGgvGllavqlAkal.GasrViavdgspeklelakelGadh
00488631   1/1  allcagltayhalvragvkpgdtVlviGaGgvGllavqlAkalGa..rViavdrseeklelakelGadhv
00512641   1/1  AalplagltAylalvelaglkpgetVlvhGAaGgvGlaavqlAkalGa..rViatagseeklelakelGa
00405511   1/1  allcagltayhallragllpgktvlvtGaGgvGlaaaqlaaalGa..rViavdrseeklelarelgadvv
00432761   1/1  alglalltavlavlaagvkpgktvlvlGaGgvGlaaaqlakalGa..kVvavdiseeklelakelGadfv
00367461   1/1  --lellsvalhallraglvpGktVlviGaGgiGlaaalaakalGa..kViatdrspekleqakelgadfv
00423661   1/1  alvltlatavralllagvlpgakVlvlGaGvvGlqaaalakalGag.eVtvvDisperleqaeelGadlv
00397801   1/1  ----CaltvayaalkraglkpgdtvlvvGaaGgvGllavqlak.algaarviavdlsdeklelakelgad
00487991   1/1  eAAalplagltaylalveraglkpgetVlvtgaaGgvGlaavqlAkalGa..rviatagseeklelakel
00383791   1/1  lllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqlla.aaGvgkvilvDrdeealerarrlgp
00387111   1/1  ----pgltAyvglleiakvkpgetVlvlGaGgvGllavqlaklaGa.grviavdgsdeklelakelGada
00385671   1/1  cglltaliglvevaklkpGk..tvlvlGlGgvGllalllakaaG.agrvigvdindeklelakelGathv
00502041   1/1  lplaglTAylallelaglklspgetvlvhGAaGgVGllavqlAka.lGasrViatagseeklellvkelG
00429061   1/1  ---------------aklkpgktvlvtGAaggvGlaaaqlakalGa..rViatarseeklellkelGadv
00367441   1/1  lglafgtgfllllelagvlpgktVlvfGlGgvGlaaillak.aaGagrviavdlndeklelakslGadlv
00485161   1/1  lplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGa..rViavdrseeklellkelg
00374371   1/1  ervltglgal.....agllpgkrvlViGaGgiGleaAaalarlGa..kVtvvdrrpellerleelgakfv
00484541   1/1  -----------------------mmkklkvaiiGaGniGlalarallalaggaevvavadrdpekaglal
00508901   1/1  lplaglTAylalfalleraglkpgetvlvtGAaGgvGslavqlAkalGa..rViatagseeklellrelG
00472761   1/1  -ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideekleglardlldil
00445261   1/1  llltglltawlplllagllpgktvgviGlGgiGlavarlakalGa..rViaydrspeklelakelgadfv
00500401   1/1  lsleeaAalglaglTAylallelaklkpgetvlvhgAaGgvGsaaiqlakalGa..rviatagsdeklel
00484901   1/1  kllkllkpgdlvllllannlllpltlrvnklkltrfgllnvlelsgknavahydlsndvyellldpaysd
00473291   1/1  veafgrgtqitqpa..vaalllellglkpGarVLDlGcGt.GaltlalaravgpggrvvavDispealel
00484691   1/1  ---DgigavsllkrlgvdlpgkrvlviGaGgagraaalallalga..evtvvnrtlekaeelaellad..
00475801   1/1  vlisqpellalllelldlkpgdrvLDiGcGt.Gylalalaklvg..grvtavdispealelarenaerlg
00423401   1/1  ylavllaalllcrflgglgllltlagglagkkvlviGaGgvGlaaarllaalGa..kVtvldrnpekleq
00446051   1/1  ----------------------------------------------------------------------
00478471   1/1  lLsDilPTGylaaelagikpGdtvavfGaGPvGllaaasAl.llGaervivvDrvpeRLelaeelgaeti
00496861   1/1  illlgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGy..kViaidrseekleklkelgadv
00472781   1/1  --ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideekleg---------
00479921   1/1  -----------------------pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerlealaadle
00421801   1/1  -------------------DgigavsllkrllvdlpgkkvlvlGaGgiGralalalaa.aga.evvvvnr
00367432   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
00423651   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00461131   1/1  ......................................................................
00408171   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00367431   1/2  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00462531   1/1  hvinykdledlveavkeltggrgvdvvidavggeatleaalelllrpgGrivlvGvpggpllplplllll
00502031   1/1  hvinykdedlldlveavkeltggrgvdvvldavggpatleaalellrpgGrlvlvgvlsgpllllplpll
00481071   1/1  vinykdededlveavkeltgg.gvdvvldavggpatleaalellrpglGrivlvGvpggplpllplllll
00467251   1/1  hvinykdedlveavkeltgg.gvdvvldavggpatleaalealrpgGrlvlvGvlggplllpldllllll
00461141   1/1  vinpkdededlveavkeltgg.gvdvvleavgapaaleqalellrpggGrvvlvGvpggplplpllllll
00513271   1/1  vinyrdedlveavleltggrgvdvvidavggeatleaalellkpgGrivlvgvlgggnllelplplllll
00486731   1/1  vinykdedkdlveavkeltgg.gvdvvldavggpatleqalellrpglGrvvlvGvpggplpllplllll
00474811   1/1  hvidyrdedl...altggggvdvvldtvgg..tleaaldllrpgGrlvlvgllsggplplpllllllkgl
00476551   1/1  vinykdedlveavleltggrgvdvvldavggeatleaalellrpgGrivlvgvlggglllplplplllll
00488631   1/1  idykeedlvaell..gggvdvvldtvggpleltleaalellrpgGrlvlvGlpggplpldllllllkglt
00512641   1/1  dhvidyrdedlveavkeltggrgvdvvldtvgge.tleaaldllapgGrlvlvgllsg.lpldllllllk
00405511   1/1  idvtdedlveavleltggvDvvvdaagvpatleealrllkpggrlvlvgvaggllpldlarlllkgvnlr
00432761   1/1  vvykdedvaeavleltggadvvidtagipgilreilrllkpggvivllgllpgplplpladlllkgvtii
00367461   1/1  vvykdlsediieavaellatngggadividtagipgileeavdllkpggvivdvgladgeltvplllvll
00423661   1/1  vvpseedlaeavreltgkqgggaDlvitaagipgvlrealevmkpggvvvdvaidqgeltlplttlvlkg
00397801   1/1  hvinskeedlveevleltggrgvdvvldavgaeatlelaldllapgGrlvlvGllgglleldllllllke
00487991   1/1  Gadhvinykdedfveavleltggrgvdvvldavg.getleaaldllapgGrvvlvGlasgailplpllll
00383791   1/1  dvvvdpie.dlaeallellggrgvDlvldcvdnfetlallidalkpggipvvsgagaggqldpteillkg
00387111   1/1  vvnykdledlaealkeltggegvdvvldnvggeeallaalrlllkpgGrvvlvG----------------
00385671   1/1  vnyketekvaeevkeltdgegvdvvieavgspqtlreaisvlkkpgGtvvlvgvpsgplellpivllvls
00502041   1/1  adevinykeedlvealkeltgg.gvdvvldtvgge.tleaaldalapgGrivliglasgyvleldlllll
00429061   1/1  vidykdedlvealkeltggrgvdvvlnnvgge.tldaaldllapggrvvlvglisgynlpllllllllkg
00367441   1/1  vnpkdldeevaeavleltgggvdvvveavgsvqallqaidavrpgwGtvvlvGllgkelelplv.lvlng
00485161   1/1  advvidvtdedaveal..agggvdvvvnnag.gatlgallellapggrvvlvn........llggllltr
00374371   1/1  lltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaagipp--------------------
00484541   1/1  akelgatttvn.avddleelladp..gvDvvieatpagahaevalaale---------------------
00508901   1/1  adevidyk..dlveevleltggegvdvvldtvg.getleaalallapgGrvvl-----------------
00472761   1/1  ellgvglvvttdleealk----------------------------------------------------
00445261   1/1  vvysdedsleel...lkgaDvvilhvpltlaleevlellkpggvvvdlgaltgglinaevlalmkkgatl
00500401   1/1  lkelGadhvinykeedfveevleltggegvdvvldnvg.getleaslkllap------------------
00484901   1/1  slarfgegntll.qpelaelllelldlkpgkrvLDiGcGt.Gglalalakllgpda.rvtgvDis-----
00473291   1/1  arenlaragla..lpdnvevvvgDaedlplpdgsfDavvsdlpdpeaalaeaarlLkpGGrlvlse----
00484691   1/1  ..evvaldlddleealggaDlvinatgagmaglvlplllsllkpggvvvdvgypplitpl----------
00475801   1/1  ldnvevilgdaeellfedgsfDlvvsdaplphlleellrlLkpGGrlvlvvgtleg..............
00423401   1/1  leelgadavevdvsdtadleelvaea....Dvvinaagipgatapllvtr--------------------
00446051   1/1  ----------------------------------------------------------------------
00478471   1/1  dlseeddvlellke--------------------------------------------------------
00496861   1/1  vldvtdveellkallk.lggvdvvihtag.apvtelslsllkqllrvnv---------------------
00472781   1/1  ----------------------------------------------------------------------
00479921   1/1  dllellgvdlrattdlee----------------------------------------------------
00421801   1/1  tlekaeelaeelga.....qgdvsdleeleealggaDivvnatgaglpglllelllellkpggvvvdv--
00367432   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK-----------
00423651   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00461131   1/1  .........................................................-------------
00408171   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00367431   1/2  ----------------------------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00462531   1/1  lkgltilgslvggredlpelld------------------------------------------------
00502031   1/1  llllkgltlvgsllgtredleelldl--------------------------------------------
00481071   1/1  lkeltllgslvggrlvleel--------------------------------------------------
00467251   1/1  keltllgsllggrlpleelp--------------------------------------------------
00461141   1/1  keltllgslvggrrdleell--------------------------------------------------
00513271   1/1  lkgltlvgsllgtraelle---------------------------------------------------
00486731   1/1  lkgltllgslvgsraprdlp--------------------------------------------------
00474811   1/1  tllgsllgsrlleelldllaegklkpvil-----------------------------------------
00476551   1/1  lkeltllgsllgtredlpell-------------------------------------------------
00488631   1/1  ilgslvgsradleelldlvaeg------------------------------------------------
00512641   1/1  gltllgsllgtlllelleelldll----------------------------------------------
00405511   1/1  gsflgtraalpellellag---------------------------------------------------
00432761   1/1  gslvggrellaellellaegll------------------------------------------------
00367461   1/1  kgvtivgsvvlrllleealel-------------------------------------------------
00423661   1/1  vtvvgsvvlvanlpgavdllas------------------------------------------------
00397801   1/1  ltilG-----------------------------------------------------------------
00487991   1/1  llkgltllgsllgsrldlrellllvalgkilplvli----------------------------------
00383791   1/1  lsvrglfvlpredleelle---------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00385671   1/1  sktvrgslvg.......................grvpleelpealkr-----------------------
00502041   1/1  llllllllllkgltllgfl---------------------------------------------------
00429061   1/1  ltll------------------------------------------------------------------
00367441   1/1  ltlrGsl---------------------------------------------------------------
00485161   1/1  allplllkrgkgrivns...............skaalegltealalelagkgi-----------------
00374371   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00445261   1/1  intargglvdeeallealasg-------------------------------------------------
00500401   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00475801   1/1  ..........leellellkeagf.evvevidpvgfvpltdgle---------------------------
00423401   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00478471   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00367432   2/2  ---lgcgdlpklvdlylagklkldelithtlpleeineafellleGksirsvllf---------------