[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66691.1


[Show Plain Result]

## Summary of Sequence Search
   1::588
   5::331  2.3e-56 22.5% 0042281 00422811 1/1   ransporter transmembrane region         
 350::569  2.8e-55 38.6% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
 356::587  2.8e-52 37.5% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
 350::569  1.6e-51 37.3% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
 350::587    1e-50 36.3% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
 356::586  1.3e-50 37.2% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
 356::588  6.5e-50 36.9% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
 350::590  1.2e-49 38.6% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
 350::590  1.7e-49 37.6% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   7::351  8.8e-49 22.8% 0053060 00530601 1/1   ransporter transmembrane region         
 350::583  2.4e-48 33.3% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
 361::565  2.8e-48 35.0% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
 353::583  7.1e-48 38.1% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
 361::581  9.3e-48 38.0% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
 356::584  1.3e-47 36.9% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
 340::580  1.5e-47 34.6% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 349::570    2e-47 39.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
 356::588  9.2e-47 36.4% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
 348::584    1e-46 36.4% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
 352::582    2e-46 37.1% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
 361::569  3.9e-46 38.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
 356::570  7.7e-46 36.7% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
 356::570  5.7e-45 37.4% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
 350::570  1.1e-44 39.4% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
 332::570  9.4e-44 36.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
 339::571  1.1e-40 35.5% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
 348::558  2.9e-40 33.7% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
 294::573  3.7e-39 34.3% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
 349::551  5.1e-38 33.3% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
 328::587  5.5e-38 36.7% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
 358::588  3.2e-37 33.0% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 368::580  3.4e-34 36.7% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
 324::576  5.2e-34 31.1% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
 350::570  1.6e-33 38.7% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
 371::579  4.4e-33 36.8% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 349::571  7.6e-33 36.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
 366::580  1.3e-32 39.2% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 340::570  2.9e-32 36.2% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
 348::570  3.6e-32 36.8% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
 351::569  4.1e-32 37.3% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 370::570  5.7e-30 34.4% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
 374::561  6.5e-30 37.2% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
 363::572  1.6e-29 33.5% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
 376::532  4.5e-29 42.4% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 347::570    3e-28 36.9% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
 360::570  4.9e-28 34.6% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
 344::575  9.9e-28 33.5% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
 370::517  9.8e-27 40.4% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 340::570  1.4e-26 33.7% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 343::570  2.4e-24 34.5% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
 374::587  4.3e-24 41.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 328::565  1.3e-23 33.5% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
 363::570    2e-23 35.6% 0053253 00532531 1/1   arboxykinase-like                       
 376::570    5e-23 38.5% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
 365::563  5.7e-23 32.0% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
 371::543  6.6e-23 34.4% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
 362::549  1.1e-22 34.5% 0047841 00478411 1/1   arboxykinase-like                       
 374::558  1.8e-21 35.2% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
 364::568  1.2e-20 30.9% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
 375::537  2.9e-20 33.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
 369::547  3.6e-20 36.2% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
 323::569  5.8e-20 27.2% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 360::567  2.2e-19 32.1% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
 376::564  5.8e-19 35.6% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 377::569  1.1e-18 29.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 376::551  1.3e-18 38.0% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 363::534  1.5e-18 39.0% 0047552 00475521 1/1   arboxykinase-like                       
 369::576  2.5e-18 36.4% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 343::464  3.1e-18 27.3% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
 377::569  3.4e-18 30.5% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 368::586  4.2e-18 28.5% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 378::542  6.7e-17 31.3% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 375::538  7.2e-17 36.6% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 353::584  1.3e-16 27.9% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
 375::569  2.5e-16 31.9% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 376::566  2.7e-16 33.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 376::557  3.7e-16 30.9% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
 369::547    9e-16 27.5% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
 375::535  2.6e-15 38.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 370::550  3.9e-15 22.8% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 355::556  4.7e-15 28.7% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
 362::545  6.2e-15 31.3% 0047844 00478441 1/1   arboxykinase-like                       
 373::563  4.4e-14 30.1% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 343::570  9.4e-14 35.2% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
 375::560  1.1e-13 27.2% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
 370::576  1.2e-13 35.0% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
 373::566  1.4e-13 26.8% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 363::572  2.6e-13 30.5% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
 373::566  4.1e-13 27.6% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 353::543  7.8e-13 30.5% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 350::563  9.4e-13 32.3% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 376::559  1.4e-12 29.7% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
 376::558  1.5e-12 33.9% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 376::565  4.8e-12 24.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
 351::549  2.5e-11 25.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
 343::561  3.1e-11 31.8% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 376::550  8.6e-11 28.3% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 369::559  1.3e-10 33.3% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
 377::565  1.9e-10 23.6% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
 369::477    5e-10 29.4% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 342::549  1.6e-09 30.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 377::562  1.7e-09 26.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 369::547  2.6e-09 36.9% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
 370::558    3e-09 25.0% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
 344::547  1.2e-08 31.7% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
 369::530  1.9e-08 34.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
 369::545  3.6e-08 28.7% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
 370::523  4.7e-08 28.2% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
 350::547  7.9e-08 23.1% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
 369::545  1.1e-07 28.2% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 369::512  1.4e-07 34.0% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 369::545  1.7e-07 28.9% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 369::531  1.7e-07 36.6% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 376::573  3.2e-07 26.1% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
 373::565  4.5e-07 27.3% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
 368::589  7.3e-07 19.9% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
 376::523  1.3e-06 31.2% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 369::547  2.4e-06 35.1% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
 380::529  6.5e-06 28.6% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
 374::512  7.3e-06 28.6% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 376::543  7.3e-06 26.8% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
 376::518  2.7e-05 30.2% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
 369::553  3.5e-05 27.3% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 360::398  4.6e-05 38.5% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 372::512  6.2e-05 41.3% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 363::398  0.00012 47.2% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
 376::550  0.00012 22.2% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
 372::477  0.00016 26.4% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
 376::398  0.00016 50.0% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 376::582  0.00019 22.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
 376::562  0.00032 23.2% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
 375::398  0.00044 58.3% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
 333::548  0.00046 24.2% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 375::398  0.00048 50.0% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
 361::398   0.0005 44.7% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
 374::409   0.0005 34.3% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
 372::445  0.00052 31.0% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
 376::474  0.00085 30.5% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
 375::550  0.00086 27.0% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 338::540  0.00097 25.4% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
   1::588


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKTRQKDLTRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPREALLLPFILLI
00422811   1/1  ----ekee..krllrylkpykkllllalllallaallslllplllgrlidallpgg.dlslllllallll
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00530601   1/1  ------ep..kRllrylkpykkllllalllsllaallslllplllgqlidalllgg.dlsdpllllstll
00509431   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LVFVLRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
00422811   1/1  llallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsrltnDveaidellssl
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00530601   1/1  lllllllllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdktstGdllsrltnDveai
00509431   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
00422811   1/1  lltllralltllgalivlfylswrlalvlllllpllllltllfgkrlrklsrlvqealselnsvlvesls
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00530601   1/1  dellssllltlllalltligalivlfliswklalvlllllpllllltllfgkrlrklsrlaqealselns
00509431   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGH
00422811   1/1  girtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvlllgallvlng.....
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00530601   1/1  llveslsgirtvkafgaeerelerfdealdellkaslklarlsallspllellsalalalvlllgaylvl
00509431   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YGTGVTLAAGFLALILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTI
00422811   1/1  ...eltvgdlvafllyalqllgplsqlgsllselqrarvaaeRi....D.P-------------------
00422801   1/1  ---------------------------------------------------------------------l
00482201   1/1  ----------------------------------------------------------------------
00367901   1/1  ---------------------------------------------------------------------l
00379581   1/1  ---------------------------------------------------------------------l
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00490801   1/1  ---------------------------------------------------------------------l
00510251   1/1  ---------------------------------------------------------------------l
00530601   1/1  ng........eltvgdlvafllyalrllgplrqlgsllselqralaaaerifelld.P...E........
00509431   1/1  ---------------------------------------------------------------------M
00390411   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00440861   1/1  -----------------------------------------------------------Mpllslgepll
00378981   1/1  --------------------------------------------------------------------lp
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  -------------------------------------------------------------------lpl
00404101   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ---------------------------------------------------------------------l
00424961   1/1  ---------------------------------------------------lgepldglgplr.papgll
00361211   1/1  ----------------------------------------------------------plellgepllel
00436071   1/1  -------------------------------------------------------------------pll
00379601   1/1  -------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridg
00436511   1/1  --------------------------------------------------------------------ie
00468691   1/1  -----------------------------------------------lsvpvglallgrvldvlgepidg
00485451   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00498251   1/1  -------------------------------------------vekllglalllieklflkvlprllsll
00372301   1/1  ---------------------------------------------------------------------y
00485931   1/1  ----------------------------------------------------------------------
00367481   1/1  --------------------------------------------------------------------yv
00448931   1/1  ----------------------------------------------------------------------
00488521   1/1  -----------------------------------------------------------lllllalelll
00469451   1/1  -------------------------------------------------------------------all
00496111   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  ------------------------------------------------------------------dlsl
00368501   1/1  ----------------------------------------------------------------------
00437981   1/1  ---------------------------------------------------------------lveklrp
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  -----------------------------------------------------------pgllsllelll
00495031   1/1  --------------------------------------------------------------lsalelll
00414121   1/1  ----------------------------------------------------------------------
00464791   1/1  -----------------------------------------------lsvpvgdkllGrvldvlgepidg
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ------------------------------------------llgvrllpplppklagllplagladgd.
00462761   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00387201   1/1  --------------------------------------------------------------mssgepll
00512891   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00444381   1/1  --------------------------------------------------------------asdelekl
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ---------------------------------------------------------------------f
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  --------------------------------------------------------------eklrpvll
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  -------------------------------------------------------------vellpkvtl
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ---------------------------------------------------------------klrpvll
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ---------------------------------------------------------------------v
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------vlektgipltkllrpvll
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ---------------------------------------------------------drplleklrpvll


                         -         -         -         -         *         -         -:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
00422811   1/1  ----------------------------------------------------------------------
00422801   1/1  lllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllag
00482201   1/1  -----llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00367901   1/1  elknlslsyg..ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkg
00379581   1/1  epllevenlsksy.ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00530591   1/1  -----llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllklla
00482261   1/1  -----lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00490801   1/1  lllllllalllelleeeeellllllalllllgdpllelenlsksy.ggvpalkdvsltikpGeivalvGp
00510251   1/1  llllllllaeellelleeeelllllllllllllgdpllelenlsksy.ggvpalkdvsltikpGeivalv
00530601   1/1  .---------------------------------------------------------------------
00509431   1/1  lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdlif
00390411   1/1  ----------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgkls
00475991   1/1  --lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00458601   1/1  ----------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeil
00475891   1/1  -----lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeill
00440861   1/1  elenlsksy.ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgll
00378981   1/1  llelenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldlllls
00502741   1/1  -----lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00420701   1/1  lelenlsksyp.gggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldllll
00404101   1/1  -elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllptsGeilldgldltalslae
00466931   1/1  ----------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgk
00466971   1/1  -----llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilld
00500441   1/1  -----lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeill
00425571   1/1  elenlsksy.ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl.
00424961   1/1  elenvsksygtg.ialidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersre
00361211   1/1  enlsksyg...gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalsl
00436071   1/1  elenlsksygg..lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla....
00379601   1/1  vlelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvi
00436511   1/1  vpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGerv
00468691   1/1  lgplllllllpivrlappllelenlsksygtg.ialidvsltigrGervglvGpnGaGKttLlkllagll
00485451   1/1  -------skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlv
00468601   1/1  -----------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaa
00498251   1/1  elenlskiytgipal..dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgeesld
00372301   1/1  vlPllsdgmpllelenlrkpy.ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00485931   1/1  --------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi......
00367481   1/1  rPelldepllelengrhPllsksyg.gkvvlndislsip.gellvitGPngsGKSTllralaglllpasg
00448931   1/1  ---------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla..
00488521   1/1  evenlrist.gikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei...........
00469451   1/1  elenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlyl
00496111   1/1  elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsaeel
00495371   1/1  -------------------esalellleledltklstgikaLddvlggglpkGeivlllGpsGsGKttla
00426051   1/1  -----------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgge
00503371   1/1  ------------Mmlkslelknfkslkd.vsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgei
00381441   1/1  -------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgev
00422141   1/1  eelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifldeeell
00368501   1/1  ---------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGv
00437981   1/1  knldkvi...gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi...
00480471   1/1  -------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilld
00500611   1/1  elenltklptgipaLddvlgggipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyislee
00495031   1/1  eledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggkvlyiglel
00414121   1/1  -----------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgq
00464791   1/1  lgpllalerlpierlappllelenls.krfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagll
00532531   1/1  ------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggf
00457311   1/1  -------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyk
00475371   1/1  --------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsar
00451571   1/1  --------------------MsikkgeiiaivGppGsGKsTlaklLakll...glivldgddl.......
00478411   1/1  -----------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl....Gtilldg.dlvrlglk
00477971   1/1  -----------------------hkgelvvlvGPsGaGKsTLlnaLlgllptsgvisvsgttrpprpgev
00371631   1/1  -------------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrli
00484101   1/1  ------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldld
00379961   1/1  ------------------lslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlld
00368571   1/1  glgvllGklldgvpvtldlgel...grhllivGptGsGKStllrllaglllpd.ggrviviDpkgeyagl
00462761   1/1  ---------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr..
00496571   1/1  -------------------------GkgelivllGpsGsGKsTlarlLagll..ggsvldtgepirgepl
00487021   1/1  --------------------------rmkiivltGpsGsGKsTlarlLaell...gvvvidtddllra..
00475381   1/1  -------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavls
00475521   1/1  ------------evlalhgvsldve.gevvllvGpsGsGKStllralag....sGeilvdg.dlvdlep.
00437941   1/1  ------------------lslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidasell
00387201   1/1  evenlskry.ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreyelG
00512891   1/1  --------------------------evilltGppGvGKTTlakalagelgakf.gsvsltgrdv...rs
00490731   1/1  -----------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaad
00477011   1/1  ---------------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlna
00515531   1/1  ------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvk
00489571   1/1  --rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt................
00493431   1/1  ------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpge
00405881   1/1  -------------------------gervglvGrpgaGKSTLlnaltglkaivsgyp.............
00533501   1/1  -------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp.
00379261   1/1  ------------------lsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllga.p
00515511   1/1  ------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvk
00470731   1/1  -------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlara
00434401   1/1  ----MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaa
00478441   1/1  -----------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl....Gailvdd.dlvll..e
00468951   1/1  ----------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaL
00444381   1/1  lelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllell..garpgenvlLvGp
00532471   1/1  ------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelg
00432181   1/1  -------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvve
00510561   1/1  ----------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDll
00513251   1/1  ------------iellsdlslsipspevvllvGppGsGKstlakklaell...gfilidaddlr......
00498531   1/1  ----------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDal
00356411   1/1  --lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvklt
00503741   1/1  ifldlrplallplpdrlvgrdeeiealskalgg.....aldgvslsiepggivllvGppGvGKTtLakll
00489631   1/1  -------------------------MkgklillvGppGsGKtTlaraLaellglpf.iridgddllrell
00464411   1/1  -------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsge
00498811   1/1  -------------------------kPgkiigltGpsGsGKsTlarlLae.l...gvividgddltrelv
00439861   1/1  kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle...esre
00392701   1/1  ddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagll.........gap
00499191   1/1  -------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd...........
00406781   1/1  ------------------lslgippgknvllvGppGtGKTtlakalagel.gvpfvrisa..........
00480441   1/1  --------------------------rlivllGpsGaGKsTlaklLaellp..glivisvgdttrepreg
00495771   1/1  ------------------illdilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrd
00404191   1/1  ddl..vgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkr.ggrvlyvsa....
00513761   1/1  --------------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpe
00420941   1/1  ------------------lslgirpgkgvllyGppGtGKTtlakalagel.gapfiridg..........
00499331   1/1  -------------------PslslkkgklivltGppGsGKtTlakaLaerl...glpfidtddllrepvi
00386741   1/1  d..dvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagel.........gapfvrld
00508671   1/1  ------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvl
00437901   1/1  ------------------lslgirpgrillLyGppGvGKTtlakalakelgap.vieidaselrd.....
00533151   1/1  -------------------MsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllrelvp
00367291   1/1  tlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel.gapfirvd
00437921   1/1  ------------------lllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdl.
00517691   1/1  ------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.........
00394721   1/1  ------------------llealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrld
00409841   1/1  ------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv..
00482721   1/1  -------------------------kgkiigltGpsGsGKsTlarlLae.l...glpvidtddlyrelva
00482551   1/1  ----------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaa
00480251   1/1  -----------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrpsa
00515351   1/1  -------------------------mngklivltGppGsGKtTlaraLaerl...glpvistddllreav
00521551   1/1  ------------------lslglrpgkgvlLvGppGtGKTtlaralagllga..................
00469161   1/1  -----------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgt
00461621   1/1  -----------------------mkgmiialtGppGsGKsTlaklLaerl...glpfistddlyrevver
00476071   1/1  -------------------------kgkiigltGpsGsGKsTlaklLae.l...glpvidtddltregvl
00478081   1/1  -------------------------gkvivltGppGsGKtTlarlLaellkplgg.gvvvidtddlrrea
00527261   1/1  ------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkala
00410321   1/1  ---------yggllllkdlslelkkglkilllGlngaGKTTllnrllg----------------------
00401211   1/1  ---------------------elkrglnvgivGhvgaGKSTLlnaLlgll....................
00471271   1/1  ------------prailelesliksllekllellkrlslklkkglkva----------------------
00477561   1/1  -------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr.
00420081   1/1  ---------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsv
00523461   1/1  -------------------------a.kvalvGlpnvGKStLlnallg----------------------
00457851   1/1  -------------------------PkgklivltGppGsGKtTlakaLaerl...glpvistddllreav
00516041   1/1  -------------------------mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl..
00403151   1/1  ------------------------kglkivlvGdsgvGKTtLlnrllg----------------------
00402371   1/1  d..dviGqeealeallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrldas
00475471   1/1  ------------------------mglkvalvGlPNVGKSTLlNaLtg----------------------
00378621   1/1  ----------glklllrrlslllkkglkvllvGlpgvGKstllnrlag----------------------
00495821   1/1  -----------------------akelkvlllGlsnvGKttllnrl.kfvetypTigvn-----------
00478391   1/1  ---------------------msikkgklilltGppGsGKtTlaralaerl...glpvidgddllrelvg
00478131   1/1  -------------------------kgkvivltGppGsGKtTlarlLaellkplg.lgvvvidgddlrre
00487061   1/1  ------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdy
00418301   1/1  dd..viGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll.grpfirv


                         -         -         +         -         -         -         -:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQ
00422811   1/1  ----------------------------------------------------------------------
00422801   1/1  llkptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararale
00482201   1/1  dilglslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldr
00367901   1/1  llllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqlt
00379581   1/1  lslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgl
00530591   1/1  gllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalra
00482261   1/1  ildlslaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldr
00490801   1/1  nGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.............
00510251   1/1  GpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll...........
00530601   1/1  ----------------------------------------------------------------------
00509431   1/1  lgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpq
00390411   1/1  dlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnl
00475991   1/1  Geilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalrallllll
00458601   1/1  ldgkditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalra
00475891   1/1  dgkdilglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalra....lllllllglet
00440861   1/1  kpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddgltel
00378981   1/1  laelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell.....glddlldrl
00502741   1/1  ilglslaelrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellell.....gledlldrl
00420701   1/1  slaellalrrgigyvfqdpalfpgltvrenlalglllag...lskaeararalellell..glddlldrl
00404101   1/1  lrrgigyvfqdpalfpgltvrenlalgll........kaeararalellell..gldelldrlvgeLSgG
00466931   1/1  dilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellall
00466971   1/1  gkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgl
00500441   1/1  dgkdildlsl..lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaera....lelllllgledl
00425571   1/1  .lrrrigyvfqdpalfpgltvrenlalgllll...glskaeaaaralellell..glddlldrlvgeLSg
00424961   1/1  vtelleelrrviglvfqdpplfprltvaenialgaeyf....rdegadvllladsllrlagalrevlgrl
00361211   1/1  aerlragigyvfqdlalfpeltvlenlalg................rarellerlglail...drlpgeL
00436071   1/1  .lrrgigyvfqdpalfpgltvlenlalgllllgll.....ealaralellellglgdl...drlvseLSg
00379601   1/1  rklpkliltledllelenlsfsygg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppdegi
00436511   1/1  glvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpall
00468691   1/1  kpdsgeilvdGedlrelre..lrrrigyvfqdpalfpeltvlenlalgallag.................
00485451   1/1  igldifrlsarelrkrig.vfqdpallphltvpenldlgllleilervlellelvgldvvlldtyph...
00468601   1/1  e.rlgigavpqdvplfpsltvldnlalar......dlleaakaagydvvlidtaglld..ldrlvgelsg
00498251   1/1  ll...rarrlgvvlqelllfpeltveenl....................................drlpr
00372301   1/1  vdgedlr..........igyvfq......................................llervgled
00485931   1/1  ...rrigavpqlpvlfprltvlenlalg.gadlaeraeellellglegfdvvliDtag..rgrrvgelsg
00367481   1/1  gilvpgedalll..............................................rvdeiltrvgls
00448931   1/1  .areqlgivfqdpgl...tvlenlalgeleararellellgledydvvl......iDtagrlrlpselsg
00488521   1/1  ...ggkvlyvdqeeslfpltvlenlalg...........gedveellerlgl......dlldrlphqlsg
00469451   1/1  sleesleqlrrrigyvfqdpalfp........................aeellelvgle.dlldrlpge.
00496111   1/1  rerrrrigyvfqepalfpeltvlenlalgll...............................drlpgeld
00495371   1/1  lrllagllkp..evlvdgldltglspa.rggiglvfqteallppltvrenlealgldlrglld......r
00426051   1/1  sglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegld
00503371   1/1  rldgkdlliylsdlir..rgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglg
00381441   1/1  dgvdltfls....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellell
00422141   1/1  allsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlglsy..
00368501   1/1  GKTtlaralakllga.pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgl
00437981   1/1  .....rrgiglvfqliglfphltvlelvalglggilveevrellkel.......................
00480471   1/1  gkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvill
00500611   1/1  slrrrrigmvfqelgldpdltv...................arerviellelv..gllelldrlprelkr
00495031   1/1  t.lsperlrlraqsl.......................gldldellerllvidllelv..gllelldrlp
00414121   1/1  lledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid.....................
00464791   1/1  kpdsgeivvyg..ligerprevrellglllelgvlfaaellervglvaatadeppge.............
00532531   1/1  yakaigllrrkigyvfq..lfpfltvlenvalgld.....glvdeedleraenllalvgl..eeipnryp
00457311   1/1  lsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk.............llepvglpevl
00475371   1/1  ellgllgell............................................gldvlvgarggdlsgg
00451571   1/1  lreaiglvtqdgelllelidegilvpdeiv.iellrealeelda.d..gvildgfprllgqaelllsggk
00478411   1/1  d...gigmvfqdpalfplltvrengvalglllag...lskaeieervdlllelvg..lddlldrypdels
00477971   1/1  dgvgyvfqsre.lfpeltvagnfleg......aevrgnlygtsrerveelleagldvlldidpqglsggq
00371631   1/1  kllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylp
00484101   1/1  ellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalplilel
00379961   1/1  pkdlrellragiplvflnfaalpasllesel.....................................ls
00368571   1/1  arglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepe
00462761   1/1  ....lglliglvfqdpdllpfltvlenvllpllaagliv........ivdgtlllvglrealrkll....
00496571   1/1  gelir..glvfqdpllldeltvlenlalgrylhl..glilaalaagvgvvldrvg..lsdlaygfprtls
00487021   1/1  ..........gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgllldrippalsg
00475381   1/1  rdllgllreglirigyvfqdyalfprltvlenvllgll.............................llg
00475521   1/1  .lrrdigmvfqdpalfplltvrenvilgllelag..lskaealarvdellelvglddellldrlp...sg
00437941   1/1  d................................................................psels
00387201   1/1  eilldgrdlyrlsleeallllfldeileidglllvelregigyv--------------------------
00512891   1/1  arrgigyvfq.......tveellgllaelvgle.................vrgeleellktlikelsgge
00490731   1/1  ellgvlaee............................................lgldvllgarggdlsgg
00477011   1/1  llGldvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpeliel.........
00515531   1/1  lqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpil
00489571   1/1  ......................................................................
00493431   1/1  v..rgigyvfqsgalfphlivagnllegaevhgllygtskerveealekgllvlldr...........dl
00405881   1/1  ......gttldpnlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldq
00533501   1/1  ...lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydgfp
00379261   1/1  fvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgygl
00515511   1/1  lqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpil
00470731   1/1  lakel.gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpd.vildgagr
00434401   1/1  ell.lreglgidfqlpdal.....................drellreevlellgl..gevvivdvydlsg
00478441   1/1  lrgrdilmvfqppalfpllevrglniaevlela...glskaealkrvdlvlelvgld.....drypyels
00468951   1/1  DlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr..arrlgldlddll
00444381   1/1  pGtGKTtlakalakllgv.pfiridgselte..........kelvGe.......................
00532471   1/1  gaalldivdegrliglvfqdldllpllevlellaa............................rleelle
00432181   1/1  ldgrkl...........................................................vliDt
00510561   1/1  lgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgld........
00513251   1/1  ....................................................................gq
00498531   1/1  lgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldellllp
00356411   1/1  lwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpiilv
00503741   1/1  agllkpkfgeillfgkvvyvnvselldl..........................................
00489631   1/1  gel.lgrgigfgfqqgdlledatvlenlalllldeidka........................ledggvv
00464411   1/1  plge...ligevfqdgilfpdltvlenvalgrygllglikealaegviv.....ildrvglsdla.ypgf
00498811   1/1  aggglliglifqdfglfelldrellielllenlalglal..egvildalrrrllelldll..gldvvile
00439861   1/1  qlleraerlgldleell..llgllsiliad.................................plglsge
00392701   1/1  fgrvdasd.........................................................llgky
00499191   1/1  ...gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprllsg
00406781   1/1  .......................................................sellgkyvgelsggl
00480441   1/1  evlg.vdyvfvdrelfeelivagnlled......aivhgllygtskerieealdaglgvlldgfprglsq
00495771   1/1  vllirle..g..lvliDtpGfrdtileniekeeleatfeeireadlvllvidaihll-------------
00404191   1/1  ..............................................................delvskls
00513761   1/1  qlgidirdlidletvmelglgpngalvfa......................................lee
00420941   1/1  .......................................................sellgkyvgelsggl
00499331   1/1  gagtdigevfqdlllaggllvddev.......rrlllealdelllaggkvvildgf...........pgg
00386741   1/1  a.................................................................sels
00508671   1/1  ldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl..elrdelrellkeagl..
00437901   1/1  .......................................................vddlsgyvgelsgge
00533151   1/1  ggldig...........................evfqdaleaglllfddefrglllerleellargpvvi
00367291   1/1  asellek...............................................................
00437921   1/1  .rgvddlreligevlqalglllgg..............................................
00517691   1/1  .........................................gtlllllgllsfllalvldslplerergi
00394721   1/1  lsellsvsdlvgel.......................................................e
00409841   1/1  ......................................................................
00482721   1/1  ggtplgerirellgegyllpdealfrallaellfgdll.alalldgvv...........ydrlrdellae
00482551   1/1  lplelgklggkvlyistee.afsperlreralsl....gldleelldrllvidat.......dlldllel
00480251   1/1  peqlgilgellgvpvvgvltgldlagalrealell.................llegydvvliDtag....
00515351   1/1  pggtdigelfqdyllfpfltvdeni................rglllealeellaagkvvild....glsg
00521551   1/1  ................................................pfvrlsaselvgkyvgeleggl
00469161   1/1  plgelirelllegfqdlilvpdllvlellaanragl.relikellaagkgvildrfp.........lsrl
00461621   1/1  gtelgklikdyfdpgalvpd.llirlllerl.....lfldegggflldgfprtleqaeals...kpavls
00476071   1/1  lggpllerirellgegyllfdealdrellaallfglelegal.........................ldg
00478081   1/1  irelllgldlleilf..............................................eglllsdef
00527261   1/1  kel.gkpviyidlselsskgyvdleellrela......................................
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ..........................................................ldtlkgelergi
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  .........alifqdeldlfdedreegfrvpeelvrellkella..........................
00420081   1/1  ggsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaarvllad-------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  pggtrlgeviq.................dlfllggllffdeldellkerieellaag.gvildgfpldle
00516041   1/1  lrgeelgriielfdearelvpelallfideidell....akgkvvild......................
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  elle.......................................................fgkyvgafegg
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  eggrlgrdlfdedrllfrellidei---------------------------------------------
00478131   1/1  avgqlglglsieelde................alllpdalrralleealealka----------------
00487061   1/1  waavgggdllrlirelllrlg...................fgepdafdnellgellealleg........
00418301   1/1  daselte..........aelvGyesgarlrelf.....................................


                         *         -         -         -         -         +         -:560
query           AQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGA
00422811   1/1  ----------------------------------------------------------------------
00422801   1/1  llellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakglt
00482201   1/1  lpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvthdlsearlad
00367901   1/1  vlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeellellg
00379581   1/1  dtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdl
00530591   1/1  lllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakglt
00482261   1/1  lpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakgltvllvthdlseallad
00490801   1/1  .lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetrae
00510251   1/1  ...lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetr
00530601   1/1  ----------------------------------------------------------------------
00509431   1/1  dpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldg
00390411   1/1  lrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarlle
00475991   1/1  lgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvt
00458601   1/1  lllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegl
00475891   1/1  lldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdlde
00440861   1/1  dlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisal
00378981   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrl
00502741   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00420701   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrl
00404101   1/1  qrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrla
00466931   1/1  ldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrp
00466971   1/1  etlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdl
00500441   1/1  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlse
00425571   1/1  GqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilv
00424961   1/1  grelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllal
00361211   1/1  SgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdldll
00436071   1/1  GqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladri--
00379601   1/1  itiegpdel......lrnkigyvfQdpvlfpltvren.................................
00436511   1/1  rllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftll---------
00468691   1/1  ....lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre..ilellrellkelgyt
00485451   1/1  ........elSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvth
00468601   1/1  gqkqrvaiarala.apevllldeptsgldalae..llelleel..gltvlvvtKlDgtakgghdlslalr
00498251   1/1  llsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthdldeaea
00372301   1/1  lldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdle
00485931   1/1  gqkqrvaiarallllldpelllldEptsglda..lrlllellkel..gltvlvvthddgtakggaalsla
00367481   1/1  dl..ldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvt
00448931   1/1  gqkqrvaiaralaaplppevllldeptsglda..lrellellrel..gltvlvvthlDllakggadlsla
00488521   1/1  gqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvth
00469451   1/1  ...lSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH...
00496111   1/1  lSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeae
00495371   1/1  erviellelv..gleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkr
00426051   1/1  tlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerla
00503371   1/1  vslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleel
00381441   1/1  ..gldadlviilpasleellerldrrggelsggqkqRvalar----------------------------
00422141   1/1  .gdpealkdlslaippgglvlltGptGsGKtTllralagllnpd.egriltiedp.............ie
00368501   1/1  lvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrd
00437981   1/1  lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsellpallsrc
00480471   1/1  lnkidllddrllrraeaeerieellel-------------------------------------------
00500611   1/1  sggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthdlreveeladk
00495031   1/1  relsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlrevegr
00414121   1/1  ...........sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvliv
00464791   1/1  ................lsggqrqrlaiAraladdqgkpvllllDEptsgldalreillllgellseegyt
00532531   1/1  selsgGqqqrv...........illldEPtsgLdpvsr.........................leladri
00457311   1/1  dryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrd
00475371   1/1  lrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadri
00451571   1/1  adlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild-----------------
00478411   1/1  ggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalellll-----------
00477971   1/1  kqrlalaralilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleealelldrilvl--
00371631   1/1  a.eqlkrigllfqkglpealdveell......................ellldlkegle...dilvpvls
00484101   1/1  relsdgqiqrvaparallrdpllllldedtvvldkvdlasildllle-----------------------
00379961   1/1  ggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtie-------------
00368571   1/1  .ptldellellselglrdladrleklvagglagllegaektaasilellrkllallldlggpafdlrdll
00462761   1/1  gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdlsie
00496571   1/1  glgqrqrvalarallkpdlvifldeppteeldeRlrkrl.......rlgdteevlehrleraeeladrli
00487021   1/1  GqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpeelleR
00475381   1/1  glvvildggvrqrlalarallldpdvllldeplllldaalr..........dlpdlvifld---------
00475521   1/1  gqqqeilrvaiallilpvllgralallpelllldeptsaldpdl--------------------------
00437941   1/1  ggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdv
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  kqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallrrg
00490731   1/1  lrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvl
00477011   1/1  ........enralagpiagisrdairleielpglpdltlvDtPGlgsvavvd------------------
00515531   1/1  lvlnKiDlleakera....eellellgl.gdlldklpse....lsgGq----------------------
00489571   1/1  lallelrntteagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrvavldd.
00493431   1/1  sggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleea
00405881   1/1  pvellsggekqrlalarallgkpvilvlNKiDep....tneldlellellee..lggtvvlvSahdgegl
00533501   1/1  rllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylelle---
00379261   1/1  ggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllell-------------
00515511   1/1  lvlnKiDlleaklvllllvglfdll............dglpsels-------------------------
00470731   1/1  tpeqlealldllee.....lgrpvvviilttnrevlldral.rRpgrllldep..eldpp----------
00434401   1/1  gerqr...aralasgpdvlilDgptlgldv...........lldlpdlvifvdhdlevalerrlkr----
00478441   1/1  ggerqrvailr.vllp.klllpdepgrnldvlievavlnlilkllgidallelvd---------------
00468951   1/1  llpaltveellala....................................erllsggkpqlvviDsltal
00444381   1/1  ............................segailsggfkqrvgia.lladpg.ilflDEidkllddrgea
00532471   1/1  rippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviylda
00432181   1/1  p..Gleefasggekqrvalalallreadvlllvvdadeptsfldle....llellrelllagkpvilvln
00510561   1/1  ...ldrlllldaltveellalaerll........................sggkvdlvviDsltalapal
00513251   1/1  kqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvlllde
00498531   1/1  altveellala....................................erllsggkpdlvviDsltalaps
00356411   1/1  lNKiDlleekiveellellgleykgd..rdpeelsggqkqrvalaralakdpd-----------------
00503741   1/1  ......kellrlllealglpppyq...lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvl
00489631   1/1  lldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvi-
00464411   1/1  lsggeqqrvaiarallpkpdlvllldepteeldeRllkRg...rllekleyikkrlehylelaepykd--
00498811   1/1  gplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividndlslee
00439861   1/1  ellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsql-----------
00392701   1/1  vgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtv
00499191   1/1  gqrqrvaia.....dpdvlildgptllldpe..........lrpladlvifldaspeell----------
00406781   1/1  rqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndl-
00480441   1/1  aqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleeale
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  gglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnn-----------
00513761   1/1  llttldillealelleedydyiliDtpGglelrallalllaiaral.aadeillvddptsgldaetqlei
00420941   1/1  rqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqal-------------
00499331   1/1  llqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdlielyee--
00386741   1/1  ggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivggglltel-------------
00508671   1/1  ..pllvvfldaplevlleRdrrglypeelsgglkqrvaia------------------------------
00437901   1/1  klrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvlii---------------
00533151   1/1  ldgfpggllqrealrrlllrpdlvifldaplee-------------------------------------
00367291   1/1  ....lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlr-------------
00437921   1/1  ..................kpdvlllDEi.drldpdaqnallklleelpagvtlil---------------
00517691   1/1  tidvalarllldgrkilllDtP------------------------------------------------
00394721   1/1  gglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlv---------------
00409841   1/1  .........vlldgrdllllDtPGlidfaseptnlldleii-----------------------------
00482721   1/1  lsggqgdvliiegalllepgllplpdlvifldappevlleRllkRg..gdseeeiekrleryreiaplle
00482551   1/1  lerlrrllse..............gkvdlvviDslallarael..ldepllgldarelrellrlLkrlak
00480251   1/1  glqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsva
00515351   1/1  gllqrvallrallrpdlvifldapleelleRll-------------------------------------
00521551   1/1  rqllalaraa.npg.vlflDEidklapkrsptsglddvsrrrvlnaLlrllegledl-------------
00469161   1/1  ayqlsggerqrlaidlegalllerllldepfpdlvifld-------------------------------
00461621   1/1  ggrkqrlalaralavdpe.lil------------------------------------------------
00476071   1/1  lvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldappevll-----------------
00478081   1/1  relleealalladgdvvilDgfgrllda------------------------------------------
00527261   1/1  eelgellellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDE-------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  tikigaasllldklaivsdtpg------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ...........rllaeggdvvilDgt..nltleqrealrrllkelgrpdlviyldapdee----------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  gaealreallragplpdlvifldapleelleRllkrgr.eplddteevilkrlerlrelyerliepyeea
00516041   1/1  ....gtgrlleldealellgpdlvifldap....peelleRllkr......gldeeaieerlerlreile
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  lrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg..nvrvia------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ......gki.vlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldl----------
00418301   1/1  ...............aragigllaladpgvlflDEidkllpargssggdv--------------------


                         -         -         -         *         -         -         -:630
query           IVEQGSYAELSAANGAFATLLAHRQEDI------------------------------------------
00422811   1/1  ----------------------------------------------------------------------
00422801   1/1  vllvthdls-------------------------------------------------------------
00482201   1/1  rilvlddGrivelgtpeellenpglly-------------------------------------------
00367901   1/1  lgglldrpv-------------------------------------------------------------
00379581   1/1  dealrladrilvlddGrivelgtpeel-------------------------------------------
00530591   1/1  vllvtHdlsealladrilvlddGriv--------------------------------------------
00482261   1/1  rilvlddGrivelgtpeellenpgllyt------------------------------------------
00490801   1/1  llellrelakegktvllvtHdlsealladr----------------------------------------
00510251   1/1  aellellrelakegktvllvtHdlsealla----------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00509431   1/1  lellvglnglldrplselSgGek-----------------------------------------------
00390411   1/1  llegl-----------------------------------------------------------------
00475991   1/1  HdlsealrladrilvlddGrive-----------------------------------------------
00458601   1/1  tvllvtHdldealrladrilv-------------------------------------------------
00475891   1/1  alrladrilvlddGrivelgtpee----------------------------------------------
00440861   1/1  tgegldeltvrenlalglrl--------------------------------------------------
00378981   1/1  adrilvlddG------------------------------------------------------------
00502741   1/1  drilvlddGrivelgtpeellenpglly------------------------------------------
00420701   1/1  adrilvlddGrivelgtpeellen----------------------------------------------
00404101   1/1  drilvlddGrivelgtpeelle------------------------------------------------
00466931   1/1  vstLSGGer-------------------------------------------------------------
00466971   1/1  dealrladri------------------------------------------------------------
00500441   1/1  alrladrilv------------------------------------------------------------
00425571   1/1  lddGrivelg------------------------------------------------------------
00424961   1/1  krlyPaidvl------------------------------------------------------------
00361211   1/1  dsallrpgkrp-----------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00379601   1/1  .............---------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468691   1/1  vllvthdls...ladrilvledGsita-------------------------------------------
00485451   1/1  dlreae.adrilvlrkgdivelgepqel------------------------------------------
00468601   1/1  ladrilvlgvGeivedgtpf--------------------------------------------------
00498251   1/1  ladrvlvlaggrileh------------------------------------------------------
00372301   1/1  laalladrvv------------------------------------------------------------
00485931   1/1  leladrilvlgdGeivedg---------------------------------------------------
00367481   1/1  Hdlelaalaad-----------------------------------------------------------
00448931   1/1  leladrilvlgdGeivedgt--------------------------------------------------
00488521   1/1  dldevarlad------------------------------------------------------------
00469451   1/1  ..As.drvlv------------------------------------------------------------
00496111   1/1  dladsgria-------------------------------------------------------------
00495371   1/1  lakelgvtvl------------------------------------------------------------
00426051   1/1  r---------------------------------------------------------------------
00503371   1/1  lkelekrlelle----------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00422141   1/1  yvfqspnlfp------------------------------------------------------------
00368501   1/1  gellkalkea------------------------------------------------------------
00437981   1/1  qvirfpplseeelle-------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  rdrvvvlrgg------------------------------------------------------------
00495031   1/1  leladrvvvl------------------------------------------------------------
00414121   1/1  lnKiDllselthdlellreladrilvl-------------------------------------------
00464791   1/1  vllvs-----------------------------------------------------------------
00532531   1/1  yvllsGrive------------------------------------------------------------
00457311   1/1  lgeagrsadr------------------------------------------------------------
00475371   1/1  lvl-------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00371631   1/1  ggqkqrla--------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  slgeglivl-------------------------------------------------------------
00462761   1/1  evadril---------------------------------------------------------------
00496571   1/1  alye------------------------------------------------------------------
00487021   1/1  ....llkRg-------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00437941   1/1  iefpppdeeelleilk------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00512891   1/1  rivelgpls-------------------------------------------------------------
00490731   1/1  leglgvpgvvlNkldlvaeggaalel--------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00489571   1/1  .....Gtpeellarpanpyvrell----------------------------------------------
00493431   1/1  leelldiiv-------------------------------------------------------------
00405881   1/1  dellda----------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  rpa-------------------------------------------------------------------
00444381   1/1  egggdvsreg------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00432181   1/1  KiDlldar.....eel------------------------------------------------------
00510561   1/1  elslll----------------------------------------------------------------
00513251   1/1  gslvdlgvledl----------------------------------------------------------
00498531   1/1  llllde----------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  elL-------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00498811   1/1  vvdri-----------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00392701   1/1  i---------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  lllai-----------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00513761   1/1  le--------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482721   1/1  aadlvidndgsle---------------------------------------------------------
00482551   1/1  elgvt-----------------------------------------------------------------
00480251   1/1  lilglpilflgtgenvddlevfnpgelvd-----------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00457851   1/1  ddvividas.lsieevveeile------------------------------------------------
00516041   1/1  pl--------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------