[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF66838.1


[Show Plain Result]

## Summary of Sequence Search
   1::370
   1::368 4.5e-102 45.3% 0050240 00502401 1/1   roquinate synthase-like                 
   1::370 1.2e-100 39.6% 0048580 00485801 1/1   roquinate synthase-like                 
   1::368  2.2e-98 42.8% 0043359 00433591 1/1   roquinate synthase-like                 
   1::349  8.9e-97 40.4% 0041672 00416721 1/1   roquinate synthase-like                 
   1::369  4.6e-82 41.2% 0047854 00478541 1/1   roquinate synthase-like                 
   1::370  1.2e-80 38.7% 0047653 00476531 1/1   roquinate synthase-like                 
   1::368  1.5e-44 24.2% 0036562 00365621 1/1   roquinate synthase-like                 
   1::369  2.6e-41 25.6% 0044392 00443921 1/1   roquinate synthase-like                 
   1::370


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
00502401   1/1  llrlnnflfllptrivfGkgalkelgellkklgikkvlivtdgglakklglldkvldalkeagievvvfd
00485801   1/1  lenmlnftfllptrivfgkgaldelgellkkgkkvlivtdggvakllglldrvlaale.gievvvfdgve
00433591   1/1  lnfvfllptkiifgagalaelgeelkrlgakralivtdgslkklglldrvldalkeagievvvfdgvepn
00416721   1/1  lflfllptkiifgagaleelgellkrlgkrvlivtdggllkklglldrvldaleeagievvvfdgvepnp
00478541   1/1  mllflfllptrivfgegaldelgellkelg.krvlivtdegvaklglldrvlasLeeagievvvfdgvep
00476531   1/1  mllfvfllptrivfgagaldelgellkelg.krvlivtdegvaklgg.drvlallkeagievvfddvepn
00365621   1/1  mtllvllillpykvvigegaldelgelladlgakrvlvvtdenvakl.yldrllelledagievllelrl
00443921   1/1  mellvvlillpyeivigeglleelgell.srvlvvtdenvakl.yldavlall..gvlvivfpggepnks


                         -         -         *         -         -         -         -:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
00502401   1/1  gvepnPtletveeavelarefgadliiAlGGGSviDaAKaiallllnggdlldylgvklvlkkalpliai
00485801   1/1  pnptletveelvellrefgadviiAlGGGsviDlAKavaalllnprgidfidipttllaqvd.kalplia
00433591   1/1  PtletvekavelarefgadviiAlGGGsviDtAKaiallltnpgladildllgvklllkpalpliavPTt
00416721   1/1  tletvekavelarefgadviialGGGsviDtAKaialllgnpgdlldllgvklllkpalpliavPTtagt
00478541   1/1  nptletveeale....eradviiAlGGGsviDlAKavaylrg......lpliaiPTtagtgsevtgkavi
00476531   1/1  psletveelvealleagadvviAlGGGsviDlAKavallrg......lpliavPTtagtgsevtgkavit
00365621   1/1  lvlvvpdgeasksletverlvdalleaglevdRddvvialGGGvvlDlagfvAatylrg......vpfiq
00443921   1/1  letlekivealleagldRssvlialGGGsviDlagfvAatylrg......vpfiavPTTllaavdssvgg


                         +         -         -         -         -         *         -:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
00502401   1/1  PTtaGTGSEvtrfavitdeetgvKlgiasplllPdlailDPeltltlPprltaatgmDaltHaiEayvsv
00485801   1/1  vPTtagtGsevtktavitnlegglKnligafallPdlvilDpellltlPprltaaggaDalkhaiEayvs
00433591   1/1  agtgsevtalavitdeeggvklgiasplllPdlailDpeltltlPprltaatglDalahaiEayvsllan
00416721   1/1  Gsevtplavitdeegk.klgi..pallPdlailDpeltltlPprltaatglDalahaiEayvsllanplt
00478541   1/1  tdpegknkiglfspal.PdlvivDpellltlParltaaggaDalkhaleayvsllallekllglllnplt
00476531   1/1  dpe.gvkknlvgafllPdlvivDpellltlPprltaaggaDalahaleayvsllanlenllgellslltd
00365621   1/1  vPTTllAsvDasvggktginlpggknligafyq...PkavliDpdllatlParllaaGiaeaikhalead
00443921   1/1  kaginlpggknligafy...qPkavllDpellltlParelaaGlaealkhaleadaelflllegnplsdl


                         -         -         -         +         -         -         -:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPRAA
00502401   1/1  lanplsdalalealrlilenlpkavkdpddlearenmllastlAgiafaglglnaglgavHalahplgal
00485801   1/1  liadapltdllalealrllaenlpravadgvdlkarevlldaselagraflnaglgasgaaHalehalga
00433591   1/1  pltdalalealrllleylpkavad..dlearenlllAatlaglafanaglgavHalahalgalfdlpHGl
00416721   1/1  dalalealrllleylpravad..dlearenlllAatlAglafgnaglgavHalahalgalfdlpHGeavA
00478541   1/1  dalallalrllleklpvaladpedeavtlearalmllasllaglgfsraglglgHalghalgallglfdl
00476531   1/1  alallaielileslpialadveadeldlearallllasllaglafsnaglgagHalahalgallgykfdl
00365621   1/1  allfslleeyadalallllelllelllralldpealeelilrsieaklavvaadelegglrallnlghtf
00443921   1/1  aaeelirrlieakakvvaaderelglr................ailnlghtlgHalelllgygllHGeav


                         -         *         -         -         -         -         +:350
query           KRYARLAKACGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
00502401   1/1  ygipHGlanaillpavlrfnae..aaperlarlaralg..llglsdeeaaealiealeellkslgiptsl
00485801   1/1  lygllHGeavaiglpavlaynl..glapeklaelaral.lgllglpveeaadalieallelkkslglptl
00433591   1/1  avAillpavlrfna..paaperlaelaralglllkglsleeaaealiealrellkslglpttlsdlgvde
00416721   1/1  illpavlrfnaea..aperlaelaralgvdlkglsleeaaealiealrellkslglpttlselgvdeed-
00478541   1/1  lHGeavAiglpavlrlnllaael...........................ierllellkklglpttlkdl
00476531   1/1  lHGeavAiglpavlrlnllaael...........................ierlrellkklglpttlkdl
00365621   1/1  aHaleagltygllHGeavaigmllalrls..............erlgllslee.....ierlldllkalg
00443921   1/1  aiglvlalrla............................erlglldeierllellkrlglptsl...gld


                         -         -         -         -         *         -         -:420
query           RTNPRPANAEAIRELLEELL--------------------------------------------------
00502401   1/1  selgvdeedl....dlla----------------------------------------------------
00485801   1/1  lselgvdeedl....delae--------------------------------------------------
00433591   1/1  ed....ldalaelaladr----------------------------------------------------
00416721   1/1  ----------------------------------------------------------------------
00478541   1/1  gvdeedllellelakkarl---------------------------------------------------
00476531   1/1  gvdeedllell.alakkald--------------------------------------------------
00365621   1/1  lpttlkdlglkeldleel----------------------------------------------------
00443921   1/1  ledlleallldkkvrggll---------------------------------------------------