[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67119.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
   3::261 3.9e-105 52.9% 0048498 00484981 1/1   hoenolpyruvate/pyruvate domain          
   1::260 5.1e-101 54.6% 0042073 00420731 1/1   hoenolpyruvate/pyruvate domain          
   3::263 9.7e-101 53.3% 0048078 00480781 1/1   hoenolpyruvate/pyruvate domain          
   3::262  4.4e-35 22.0% 0049923 00499231 1/1   hoenolpyruvate/pyruvate domain          
   2::260  1.3e-21 20.8% 0041093 00410931 1/1   hoenolpyruvate/pyruvate domain          
   3::208  1.9e-08 18.7% 0048843 00488431 1/1   hoenolpyruvate/pyruvate domain          
  12::248  7.2e-07 21.6% 0045046 00450461 1/1   in phosphate synthase                   
  27::242  1.1e-05 27.1% 0039781 00397811 1/1   ose-phoshate binding barrel             
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
00484981   1/1  --kvtvadllklkgkgekivmltaydallaklldeagvdvllvGdslgmvvlGlestlpvtleemiyhtk
00420731   1/1  lkrltladlrklkeegeklvmltaydalsArlaeeagvdvllvGdslgmvvlGlpdtllvtldemlyhtr
00480781   1/1  --rvtvadllklkgkgekivmltaydallaklldeagvdvllvGdslgmvvlGlestlpvtleemilhtk
00499231   1/1  --kklakllrallesgeplvlpgaydalsArlaeeagfdaiylsGaavaasllGlpDlglltldevlalv
00410931   1/1  -leklakllrellesgellvlpgaldalsarlaekaGfeaiylsGagvaasvlglpDlglltldevlelv
00488431   1/1  --lklaellrellesgdplvlpgaldalsArlaeeagfeaiylsgaavaaslglpDlglltldevlelvr
00450461   1/1  -----------iimllkriylildvdiedllelaeaaleaGadaiqlrvkdp.........spegllela
00397811   1/1  --------------------------gllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdl


                         -         -         *         -         -         -         -:140
query           AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
00484981   1/1  avvrgaksalvvadlPfgsyelsleealrnaarllkegadavklegglelaetikalveagiPvmghlGl
00420731   1/1  avvraadlalvvaDlpfgsyeaslelavanavrllkeagaaavkleggaelaetvkllvergiPvlgHlG
00480781   1/1  avvrgakralvvadlPflsyesleealrnAarllkegadavklegglelaetvkalveagiPvmgHlGlt
00499231   1/1  rriarat.dlPviaDadtG.yggsplnvartvrllieaGaagvhiED............qvgpkkcghlg
00410931   1/1  rriaravd.......lPlivDadtGfGgsalnvartvkllieaGaagvhiEDqvgpkkcGhlggkelvpt
00488431   1/1  rivravd.......lPviaDadtGygdalnvartvrllieaGvagihiEDqllp.Krcghlggkvqvlvs
00450461   1/1  eaikelakkvdvplivndg..............velaleagadgvhlggpdllleaarelglgvivgvsv
00397811   1/1  lllgdpvelakayeeaGadalhvldl.....daafaggvtrgvllelikeiaeavp..ipvqvgggirsl


                         +         -         -         -         -         *         -:210
query           PQSVNIFGGYKIQGRGDAGQVLLDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQ
00484981   1/1  tPqsvnllGgykvqGkdeeaeklledalaleeaGafalvlelvpaelakliteelsiPtiGiGaGpgcdG
00420731   1/1  ltPqsvgllgGykvqgkdeaaeklladalaleeaGafalvlelvpaelakliteelsiptiGiGaGpdcd
00480781   1/1  PqsvnllGgykvqGkdeeeaeklledalaleeaGafalvlelvpaelakliteelsiptiGiGaGpgcdG
00499231   1/1  gkplvpleeaveriraardarlgvdfliiaRtdalllggleeaieRalayaeaGAdaifveglpdleeia
00410931   1/1  eeavekikaarlavlgvdlliiARtdalllggle.......eaieRalayaeaGAdlifiealpdleeir
00488431   1/1  leeaveriraaraaragvdfviiARtdaylaglgldeaieralayaeaGAdaifveglypdleeiraf--
00450461   1/1  ht........................leealeaeelgadyillgpvfptgtkpgfgplglellrelveav
00397811   1/1  edlaaaiivfleaaiillnaGadaviigsaaltnpdeahgyllsqfllpllaelakeygaqaivvgidak


                         -         -         -         +         -         -         -:280
query           ILVMHDAFGITGGHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEEHSFH-----------------
00484981   1/1  qvlvlhDllGllegllPkfvkryadlaelilealkayveevksgafPseeh-------------------
00420731   1/1  GQvlvlhDllGltsgllPkfvkryldlaglieealkeyveevksgafPge--------------------
00480781   1/1  qvlvlhdllGltsgllPkfvkryldlaelilealkayveevksgafPseehsy-----------------
00499231   1/1  afaeavdlplpvnmlpggaspllslqelaelGvlrviyglallraaalalle------------------
00410931   1/1  afaeavkaplpvnllaygasplfsldeLaelGvrrviyglallraaakal--------------------
00488431   1/1  ----------------------------------------------------------------------
00450461   1/1  kipviasGGitpenaaealeaGadgvavgsailgapdp--------------------------------
00397811   1/1  rgkggaallddpelveaiveavkeavp.vpvt--------------------------------------