[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67239.1


[Show Plain Result]

## Summary of Sequence Search
   1::309
 257::305  9.8e-12 36.7% 0046275 00462751 1/1   domain-like                             
 257::305  4.7e-11 36.7% 0045977 00459771 1/1   domain-like                             
 255::305  1.7e-07 30.0% 0035607 00356072 2/2   domain-like                             
 255::305  4.6e-07 28.0% 0036286 00362862 2/2   domain-like                             
 204::241      3.7 18.4% 0036286 00362861 1/2   domain-like                             
 204::241       18 18.4% 0035607 00356071 1/2   domain-like                             
   1::309


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKLTISNNHDTIY
00462751   1/1  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           CDEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIPTQRLGALYALIPNEQQTKMAVPTEKAQKIIYTPDFP
00462751   1/1  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPYFLLFLLTAFLRLPESYEIILSSAQITLKER
00462751   1/1  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00362861   1/2  ---------------------------------------------------------------dderler
00356071   1/2  ---------------------------------------------------------------ddlrler


                         -         -         -         +         -         -         -:280
query           VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
00462751   1/1  ----------------------------------------------lRlelAkrlLletdlsiaeiAlel
00459771   1/1  ----------------------------------------------lRlelAkrlLletdlsiaeiAlel
00356072   2/2  --------------------------------------------ddlrleralelleenlaedlsleelA
00362862   2/2  --------------------------------------------dderleralelleanldeplsleelA
00362861   1/2  alelleanldeplsleelAaavglspshfsr---------------------------------------
00356071   1/2  alelleenlaedlsleelAalvgfspshfsr---------------------------------------


                         -         *         -         -         -         -         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFIKMANH-----------------------------------------
00462751   1/1  GfsslsaFsraFkklfgvtPseyrk---------------------------------------------
00459771   1/1  GfsslsaFsraFkklfgvtPseyrk---------------------------------------------
00356072   2/2  alvgf.spshfsrlFkkltgltpse---------------------------------------------
00362862   2/2  aavgl.spshfsrlFkkltgltple---------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------