[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67339.1


[Show Plain Result]

## Summary of Sequence Search
   1::135
   1::135  3.5e-35 36.3% 0046737 00467371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  2.2e-32 36.5% 0049435 00494351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  5.7e-32 37.3% 0048964 00489641 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128    6e-32 36.0% 0049434 00494341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  7.6e-31 34.9% 0049535 00495351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  4.3e-30 35.8% 0047894 00478941 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  1.2e-29 37.1% 0047558 00475581 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  1.6e-29 36.3% 0052095 00520951 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  4.6e-29 45.3% 0049436 00494361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  9.7e-29 33.9% 0048855 00488551 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  1.2e-28 36.1% 0046683 00466831 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130    2e-28 36.2% 0051634 00516341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  2.5e-28 37.3% 0049534 00495341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::133  4.6e-28 29.0% 0049443 00494431 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  6.1e-28 35.4% 0049803 00498031 1/1   alase/Bleomycin resistance protein/Dihy 
   1::124  6.4e-28 37.3% 0048015 00480151 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  9.7e-28 38.3% 0048209 00482091 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  2.4e-27 37.0% 0047830 00478301 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  2.8e-27 30.2% 0049444 00494441 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  4.7e-27 35.3% 0048208 00482081 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  5.6e-27 37.0% 0049725 00497251 1/1   alase/Bleomycin resistance protein/Dihy 
   4::125    1e-26 36.1% 0051145 00511451 1/1   alase/Bleomycin resistance protein/Dihy 
   1::126  1.5e-25 39.1% 0046043 00460431 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  1.6e-25 36.4% 0043737 00437371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  2.8e-25 31.9% 0047985 00479851 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  3.5e-25 37.8% 0048412 00484121 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  6.5e-25 38.8% 0046682 00466821 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  1.4e-24 36.3% 0047893 00478931 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  2.1e-24 35.4% 0046521 00465211 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  2.7e-24 36.6% 0046684 00466841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  3.3e-24 30.9% 0036022 00360221 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  4.3e-24 40.5% 0049036 00490361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  3.9e-23 39.1% 0047984 00479841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  2.3e-22 36.1% 0049683 00496831 1/1   alase/Bleomycin resistance protein/Dihy 
   1::125  5.5e-21 38.5% 0051065 00510651 1/1   alase/Bleomycin resistance protein/Dihy 
   1::126  1.2e-20 35.9% 0049133 00491331 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  2.1e-20 35.7% 0053079 00530791 1/1   alase/Bleomycin resistance protein/Dihy 
   1::124  3.2e-19 33.9% 0051635 00516351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  6.5e-09 24.3% 0044219 00442191 1/1   alase/Bleomycin resistance protein/Dihy 
   1::132  7.3e-08 28.6% 0046159 00461591 1/1   alase/Bleomycin resistance protein/Dihy 
   1::135


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
00467371   1/1  mgldhvvlrvsDleaalaFYtdvLGfelverfdledggvgyaflrlgggahglvlelfeppdgapappgp
00494351   1/1  manpmgllgidHvalaVpDleaalaFYtdvLGfelvayfdskdvetpeggfrsaflrlpg..ggirleLt
00489641   1/1  nglllellldlllpasepmmilgidhvalpvsDleaaaaFYtdvLGfelvervdfpdggfrlaflrlggg
00494341   1/1  kvdslpnpmgllgidhvalavpdleaalafYtdvLGfelvarvdledggrslaslalrs..gdgrlelte
00495351   1/1  pmgllgidhvvlalavgdldaalafYtdvLGfelvarfrdldvegpeggfrsaflrlpd..ggirleLte
00478941   1/1  msgppmgimgldhvvlrvsDleaalaFYtdvLGfelvdrfvleglddggvrlaflrlgg....ghlelal
00475581   1/1  mkpmilgldhvalavsDleaalaFYtdvLGfelvarvdledggvrlaflglavlaglggirlelleppgp
00520951   1/1  pmgldhvvlrvsDleaalaFYtdvLGfelvervddpdggvgyaflrlgggadghvlelteppdpappphg
00494361   1/1  mslpalpnpmgilgldhvglavpDleaalafYtdvLGfelvarveledggtslaflglglgdirlellap
00488551   1/1  mmimgldhvvlpvpDleaalaFYtd.LGfevverfpdpdggvyyaflrl....ggahlelalap.....a
00466831   1/1  GmimgldhvvlpvsDleaalaFYtd.LGfelvertpdpdggvtyaflrlg....gthlelalapgpep..
00516341   1/1  MtgilgldhvalrvsDleaalaFYtdvLGfelvdrvpdlddggvtlaflglggggiglaltlppgpeapp
00495341   1/1  nplgllgldhvvlavgdleaaaafYtdvlGfelvarhdsedgkvalavlll..rqggivlelneplgedg
00494431   1/1  gplpnpmgllgidhvalavsDleaalaFYtdvLGfelvarvdledggfglaflal..gdggirleltepl
00498031   1/1  lliihvaLrvdgdleealaFYtdvLGfellrrldfpeagaftlvflglgggvlhaeltlggtllllldag
00480151   1/1  mitgldHvvlrVsDleaslaFYrdvLGfrlvertd......glaflrlggghlllllllleapg......
00482091   1/1  MgitgldhvvlrvsDleaalaFYtdvLGfelvertddpdggvtyaflrlgg....ggielalfegp....
00478301   1/1  MgldhvalpvsDleaalaFYtd.LGfelvdrtddgg....yaflrlg...ggavlelllppdgespiakf
00494441   1/1  lsgiflpgfellllelpdpmgllgidHvaiavplgdldaalafYtdvLGfelvarvdfpdleggyrgvts
00482081   1/1  mmmgitglghvvlrvsDleaalaFYtdvLGfelvdrgddgv.....aflrlgdgglvlalvlp.......
00497251   1/1  kmmsvmglmgi.hvalrvsDleaalaFYtdvLGfelvdrfddpd.gfgyaflrlggg..givlalteapd
00511451   1/1  ---gmmltkigrmlhvgvldvedalaFYtdvLGfelvrrfdfpdappgglaggvtlaflglg.gstlall
00460431   1/1  vmmilgldhvalpvsDleaalaFYtdvLGfelvdrgdd......yaflrlgg....tvlelalapgpepp
00437371   1/1  MknpvmllrldhvalavsdleraiaFYed.LGfevvaredddgeltllllglpgggvrvaflrlggg..e
00479851   1/1  rvslrvmgilglghvvlrvpDldkalaFYtdvLGfelvdrvddlllpgggfrlaflrlgg..dhhslalv
00484121   1/1  milgldhvvlpvsDleaalaFYtdvLGfelvdrgdd......yaflrlgg....thlelalapgpdppda
00466821   1/1  lplpaspvpapmgimglghvvlrvsDleaalaFYtdvLGfelvdr......gggyaflrlgd..ggavle
00478931   1/1  pimglghvvlrvsDleaalaFYtdvLGfelvdrdd......gyaflrlggg..hlelalvpgp.......
00465211   1/1  mkllhvvlpvkdleaslaFY.elLGfevvfrfdd......yaflrlgg....lvlelleapg...dppgg
00466841   1/1  vlprpllpmmgilrlghvvlrvsDlekaraFYtdvLGlevvdrdeg......lvflrlggggdhhslalt
00360221   1/1  mgltgidhveiavpagdleaaldfYedvlGfelvarhdietggfglaslvllsrqgdirlelneplgpdk
00490361   1/1  MikilglhvalpvsDleaalaFYtdvLGfelvergdd......yaflrlgg....avlelalapgpepaa
00479841   1/1  SimglghvalrvsDleaalaFYtdvLGfelvdrtd......glaflrlgg..gglelalt.......pap
00496831   1/1  MkmkllhiaLrvdgdleealaFYtdvLgfelvrrvpdpggaf......lglgggvllalltlgglalmas
00510651   1/1  mmglghvvlrvsdleaalaFYtdvLGfelvdrdd......glaflrlgd..gglvlalv....ppapagg
00491331   1/1  MilgldhvvlavsdleaaaafytdvLGfelvervddetggtalsaflrlgg....trlelllpedpepp.
00530791   1/1  MklihvalavsdleaaiaFYedvlgfevlrelgg......yaelrlg....gatlalvlakdapvppgg.
00516351   1/1  lplllalmmitglghvtlrVsdleealaFYtdvLGlelvkrtdn.....yhlflgaggghhglalfewpg
00442191   1/1  mmmmkitpylvfngadaeeAlaFYksvfgasevlrltrygdapegpagkvmhaeltlggqllmaldagpe
00461591   1/1  lpnplgllgidhvefavgdadaaaafye.alGfelva....ghrsvasallrqgd......irlvlnlep


                         -         -         *         -         -         -         -:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN-----
00467371   1/1  glhhlafevddldaavarlkaaGvevleepgdhpgggvrsayfrDPdGnlielvepldagrplls-----
00494351   1/1  eplgteddpsqiaeflekhlgpGvqhiafrvdDidaaverlraagllgGvevlgeprd------------
00489641   1/1  vhdpldlllivalalsggtvlelteapgpeppsqilaplgnlggvglhhlafevdDld------------
00494341   1/1  plnpdaagvlelllnlgtspiaeflekhgpgvqhiafrvdDidaaverlraaGvefls------------
00495351   1/1  plgpdgrspiaeflekhlgpgvqhiafrvdDidaavarlkaaGvevleePrtyydglg------------
00478941   1/1  apg....pgggglhhlafevddldaldaalarlkaaGvevlgpprdgpgg.grsayfrD-----------
00475581   1/1  espiaefldkhggpvglhhiafrvddvdaavarlkaaGvevlgepgdrpggggevrs-------------
00520951   1/1  tglhhlafevddldaavarlkaaGvevleep.....gggrsayfrDPdGnlielvqdgd-----------
00494361   1/1  pdpgpvlelthnlgvesldlldlspaaaflerhgpglahiafrVddldaavarleaaGv-----------
00488551   1/1  gggglhhlafevdsredldaalarlkaaGvpaevlgepgdhgpgggrsayfrDPdGnl------------
00466831   1/1  ...glhhlafevdsredldaavarlkaaGvrlevlrgpgdhpggggrsayfrDPdGnli-----------
00516341   1/1  aalgggglhhlafevddldaldallarlkaaGvevl.epgdrpgg..rsayfrDPdGnli----------
00495341   1/1  paasqiaeflaahgpgvqhialrvdDvdaavarlvaaGaevleppadyyggggllrfa------------
00494431   1/1  gepdspaaefldkhgpgvhhlafrvdDvdaavarlraaGveilgepvryydepgglrsayfrD-------
00498031   1/1  peeppeagggvhlafsvddvdevdayarllaaGgevlmpptdtpwg.grfayfrDpdGn-----------
00480151   1/1  ggglghlafsvddldaalarlraagvevlegpvd..rgggrslyfrDPdGnliE----------------
00482091   1/1  gggglhhlafevddldaldaavarlraaGvevlgepgdhpggggrsayfrDPdGnlie------------
00478301   1/1  lpagggglvhlafevdsrddldaavarlkaaGvevlgepgdrpgg.grsayfrDPdGn------------
00494441   1/1  vflal..pdgdirleLtepldpeddspiaeflekhlgpGvqhiafeVdDidaaverlk------------
00482081   1/1  pagggglhhlafevpsrddldaavarlkaaGvevlrepgdrpygsgrsayfrDPdGnl------------
00497251   1/1  gapaaagpglhhlafevddreeldaavarlkaaGvevvgepgd.pgg.grsayfr---------------
00511451   1/1  eapdggpapagnpgvglvhlafevddvdaavarlkaaGgvevlgppgdrpggrr.---------------
00460431   1/1  ....glvhlafevddldaalarlkalglellalaGvevlgepgdrpgg..rsayfr--------------
00437371   1/1  irlelleppdpdsaiaeflakphggglvhlafevdDidaavarlraaGvevlgep---------------
00479851   1/1  pg......pepgglhhlafevddlddldaaadrleaaGvev.lgpprhgpgggrs---------------
00484121   1/1  gggglhhlafevdsedldaavarlkaaGvevlee..p..pgggrsayfrDPdGnl---------------
00466821   1/1  lalppgpep.....glhhlafevpsrddldaavarlkaaGvevlrgpgdhpyGvgrsay-----------
00478931   1/1  ggglvhlafevpsrddldaalarlkaaGvevlggpgdrpggrrvlysayfrDPdGnli------------
00465211   1/1  ggvhlafevddvdaayarlkaaGvevllepvlrltepvdepwgg.reayvrDPdGnll------------
00466841   1/1  eg......pap.glahlafevdsrddldaaaarlraaGvevlrgpgdhepgggrf---------------
00360221   1/1  sqiaefldayhgpgvqhiAfrVdDidaaverlralGaefldepvdtygl..rlaf---------------
00490361   1/1  a....vhlafevddldavlarldrllaaGvtiliepgvrepgdhpgg..rsayfrDP-------------
00479841   1/1  gpglhhlafevdsrddldaalarlkaaGvevlgepgdrpggrrvfysayfrDPdGnli------------
00496831   1/1  dggpdagggvhlalevddreevdalyerllaaG.tvvmpptdtpwggrf.ayvrDpd-------------
00510651   1/1  gglvhlafevpsrddldaalarllaaGvtvleep....pgggrsayfrDPdGnli---------------
00491331   1/1  ...gvhhiafrvddedldaaverlkaaGvevlgepiregdg.grvfyfrdpdgnli--------------
00530791   1/1  ggvhlafevddvdaayerlkalGveilreptdepwgl.reavvrDPdGnlielvqpl-------------
00516351   1/1  apap.rpgtgglhHlafrvddredldaalerlkaaGvpvl...gpvdhgggrsi----------------
00442191   1/1  faftfpea...................vslylsvddvdeadrlakalaagGkvlmpl-------------
00461591   1/1  dsqiaeflekhgpgvqhiAfrVdDadaaverlvarGaefld..ppdgygevliaairgiggv--------