[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67354.1


[Show Plain Result]

## Summary of Sequence Search
   1::137
   1::137    2e-31 31.4% 0050180 00501801 1/1   sterase/thiol ester dehydrase-isomerase 
   2::138  4.3e-30 27.0% 0048478 00484781 1/1   sterase/thiol ester dehydrase-isomerase 
  10::136    7e-29 25.4% 0051590 00515901 1/1   sterase/thiol ester dehydrase-isomerase 
   1::136    4e-27 27.9% 0050179 00501791 1/1   sterase/thiol ester dehydrase-isomerase 
   2::136  6.3e-26 30.4% 0048889 00488891 1/1   sterase/thiol ester dehydrase-isomerase 
  17::139  1.3e-25 29.8% 0051358 00513581 1/1   sterase/thiol ester dehydrase-isomerase 
   4::139  4.9e-25 29.3% 0049396 00493961 1/1   sterase/thiol ester dehydrase-isomerase 
   1::135  2.9e-23 23.9% 0052559 00525591 1/1   sterase/thiol ester dehydrase-isomerase 
  16::133  2.2e-22 28.7% 0048813 00488131 1/1   sterase/thiol ester dehydrase-isomerase 
  13::137  1.5e-21 25.2% 0052350 00523501 1/1   sterase/thiol ester dehydrase-isomerase 
  17::139  4.5e-21 26.1% 0047497 00474971 1/1   sterase/thiol ester dehydrase-isomerase 
   9::138  7.3e-20 27.0% 0047466 00474661 1/1   sterase/thiol ester dehydrase-isomerase 
  10::137  9.1e-20 22.1% 0053001 00530011 1/1   sterase/thiol ester dehydrase-isomerase 
  28::136  3.8e-17 23.4% 0051233 00512331 1/1   sterase/thiol ester dehydrase-isomerase 
  27::135  3.3e-16 26.6% 0052337 00523371 1/1   sterase/thiol ester dehydrase-isomerase 
  33::137  2.7e-15 24.3% 0052965 00529651 1/1   sterase/thiol ester dehydrase-isomerase 
   5::137  2.2e-12 28.1% 0049564 00495641 1/1   sterase/thiol ester dehydrase-isomerase 
  32::136  2.7e-11 20.8% 0052966 00529661 1/1   sterase/thiol ester dehydrase-isomerase 
  30::136  4.7e-10 19.0% 0051338 00513381 1/1   sterase/thiol ester dehydrase-isomerase 
  23::131  6.1e-08 23.1% 0052592 00525921 1/1   sterase/thiol ester dehydrase-isomerase 
  26::131  1.1e-07 20.2% 0050275 00502751 1/1   sterase/thiol ester dehydrase-isomerase 
   1::137


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFGLLHGGASAALAETLGSMAG
00501801   1/1  dmlllpellaallallaldpfarllgieivevgdgrvvlrlpvrprhlnppGtvhGGalaalaDtaagla
00484781   1/1  -mtlpellaallallaripfarllgielvelgdgrvvlrlpvrpehlnppGtvhGGalaalaDtaaglaa
00515901   1/1  ---------llrallaldpfarllgielvevgdgrvvlrlpvrprllnppGtvhGGalatlaDtaaglaa
00501791   1/1  dmllleellarllallalipfarllgielvevgdgrvvlrlpvrprhlnplGtvhGGalaalaDtaagla
00488891   1/1  -msilkldllaellallagipfarllgirlvelgdgrvvlrlpvrprhlnppGtvhGGalaalaDeaagl
00513581   1/1  ----------------msllldlpklldlelllaallakipfarllgirivelgdgrvvlrlpvrprlln
00493961   1/1  ---dmpllleelleallakipfarllgirivelddgrvvlrlpvrpr.lnplGtvhGGalaalaDlaagl
00525591   1/1  lpglellpallrallagppfarllgielvevgdgevvlrlpvrpehtnppGivhGGvlaallDeaaglaa
00488131   1/1  ---------------mpldleelleallarypflrllgiriveledgrvvlrlpvrpehlnppgtvhGGa
00523501   1/1  ------------elllerppflelllgirivevedgevvlrlpvrpehlnplgtvhGGalaallDeaagi
00474971   1/1  ----------------ripfarllgiriveledgrvvlrlpvrpehlnppgivhGGalaallDeaaglaa
00474661   1/1  --------lldleeilellphrellg.rfvelsdgevtlrlpvepahvlnpfgivhGgllaalldtaagi
00530011   1/1  ---------allperypfllvdpfaellgdirivevedgrvvlrlpvrpghlnphgivhGGvlaalldea
00512331   1/1  ---------------------------elvevsdgrvvlrlpvrpehtnphGivhGGvllallDeaagia
00523371   1/1  --------------------------kpllklgltaeleltVteeltapflglggllsVlaTpalvalmE
00529651   1/1  --------------------------------epleedgevvlrlpvrpehlnphGivhGGvlltlldea
00495641   1/1  ----mpdllqelldlllnliPlsralgikvvevgdgrleltaplapnl.nhhgtvfGGsiatladlaggg
00529661   1/1  -------------------------------g...vvlrllvrpehlnphgivhgGvlltlldeaagiaa
00513381   1/1  -----------------------------evedgrvvlrllvrpedtnalGtvhgGvlltlldeaagiaa
00525921   1/1  ----------------------llgdeiteldpgkfatltldvnpehldnehgivhGgllfaladqaaaa
00502751   1/1  -------------------------lelvevedgrvtlrllvrpedtnalGivhgGvllalldeaagiaa


                         -         -         *         -         -         -         -:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG---
00501801   1/1  alallgegvvvvtvdlninflrpvrvGtltaearvvrvgrrlavvevevtdedgklvatatlgtfvv---
00484781   1/1  lallgegvvtvtvdlninflrpvrvGtltaearvvrvgrrlavvevevydedgklvatatgtfvvldl--
00515901   1/1  lallgegvvtvtvdlninflrparvgdltaearvvrvgrrlavvevevtdd.gklvatatgtfvvl----
00501791   1/1  alallgaggrvvtaslninflrparvGtltaearvvrvgrrlavvevevydedgklvatatgtfvv----
00488891   1/1  aallllpelggrvvtaslninflrpvrvGtltaearvvrvgrrsavvevevydedgelvatatgtf----
00513581   1/1  ppgtvhGGalaalaDlaaglaallllgegvvvvtvdlnidflrparvgdtltaearvvrlgrrlqavve-
00493961   1/1  aallllgeegkrvvtvdlninflrpar.Gdltaearvddelldailellvkvgrrlavvevevydedgk-
00525591   1/1  lallg.ggrvvtvslninflrparlGdtltararvvkvgrrsavvevevtdeedgklvatatgtf-----
00488131   1/1  laaladeaaglaalll...gkrvvtasldidflrpvrvGdtltaearvvrvgrrsavvevevy-------
00523501   1/1  aalrllg.gklvvtasldinFlrpvrvGdtltaearvvkvgrrsavvevevydeedgklvatatgt.---
00474971   1/1  llllg....vvtasldinflrpvrvGdvltaearvvrvgrrsavvevevtde.gklvaeatgt...vdr-
00474661   1/1  aa.....pgklvvtasldinFlrpvrvGdtltaearvvkvvgrslv.vevevyde.gklvatatgtfv--
00530011   1/1  agiaalallg..grvvtasldidflrpvrvGdtltaearvvrvgrrsavvevevydd.gelvaeatg---
00512331   1/1  aarhl..ggrvvtvsldnidFlrPvrvGdvltaearvvrvgrssavvevevyvedlldgegklvat----
00523371   1/1  laaleallpfleegettvgtevnvkHlaptpvGetvtvtaelvevegrrlvfeveafdeegelig-----
00529651   1/1  agiaaasl..aggrvvtvsldnidFlrpvrvGdvltaearvvkvgrssavvevevyvedlldgegrl---
00495641   1/1  aalllldeaglggdvvtadlninflaPvtggvtavaelpeeflarllrrgrrrvvvevevyd.dgkl---
00529661   1/1  lsllgarvvtvsld.nidFlrPvrvGdvltaearvvkvgrssivvevevyvedlltgegrlvatat----
00513381   1/1  arha..ggrvvtasvdninFlkPvrvGdvleaearvvkvgrssmevevevyaedllsletgegrlv----
00525921   1/1  al.....nglvavtgslnvrFlrpvkpGdtlvaearvlkvggrsvvvevevynevggelva---------
00502751   1/1  arha..ggrvvtasldsidFlrpvrvGdvlevearvvrvgrssmevevevyvedlldgdgk---------