[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67435.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
  88::303  2.4e-42 32.9% 0049998 00499981 1/1   lasmic binding protein-like II          
  88::301  1.3e-41 32.1% 0045790 00457901 1/1   lasmic binding protein-like II          
  89::301  1.9e-40 34.0% 0047313 00473131 1/1   lasmic binding protein-like II          
  88::294  3.8e-40 34.8% 0052806 00528061 1/1   lasmic binding protein-like II          
  93::298  2.4e-39 34.8% 0047462 00474621 1/1   lasmic binding protein-like II          
  87::296  5.9e-25 24.4% 0052509 00525091 1/1   lasmic binding protein-like II          
   6::114  1.8e-20 36.9% 0045910 00459101 1/1   ed helix" DNA-binding domain            
   4::92   2.4e-20 33.7% 0047461 00474611 1/1   ed helix" DNA-binding domain            
   1::87   1.4e-17 36.8% 0052508 00525081 1/1   ed helix" DNA-binding domain            
   2::90   1.3e-05 25.6% 0043164 00431641 1/1   ed helix" DNA-binding domain            
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQR
00499981   1/1  ----------------------------------------------------------------------
00457901   1/1  ----------------------------------------------------------------------
00473131   1/1  ----------------------------------------------------------------------
00528061   1/1  ----------------------------------------------------------------------
00474621   1/1  ----------------------------------------------------------------------
00525091   1/1  ----------------------------------------------------------------------
00459101   1/1  -----llklkllllleldggllldlrllrlllavaetgsisaAAkalglsqsavsqaikeleellgvpLl
00474611   1/1  ---ldlrllrlflavaelgsftaAAerlglsqsavsrqikrLEeelgvrLfeRtgrglvlTeaGelllel
00525081   1/1  lllllldlnlLrvflavaelgsftrAAeelglsqsavsralkrLeellgveLfvRtgrglvlTeaGelll
00431641   1/1  -srtrlliLllLlealegelsftelaealglsqstvsrhlkkLee...lglveregkyysLTekGeelle


                         -         -         *         -         -         -         -:140
query           CLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
00499981   1/1  -----------------TideldagglsgtlrigappslaalllppllarfraryPdvrlelvegssdel
00457901   1/1  -----------------TdglsGtLrigappsfaayllppllarfraryPdvrlelveglsdelldllae
00473131   1/1  ------------------gglsGtLrigappslaalllppllarfraryPdvrlelveglsdelldllae
00528061   1/1  -----------------TgglsGtlrigappslaalllppllarfraryPdvrlelveglsdelldllae
00474621   1/1  ----------------------vGtlrigappslaalllppllaafraryPdvelelveglsdelldlll
00525091   1/1  ----------------FdpaessgtfrigvsdslaltllppllarlrkeaPgvrlelvelpsdelleaLr
00459101   1/1  ertgGgkggrgvvlTeaGerllelarrllaeleealeel.....--------------------------
00474611   1/1  arrllalleealallrdldggl------------------------------------------------
00525081   1/1  elarrllalleealeel-----------------------------------------------------
00431641   1/1  llrellelleellelllell--------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
00499981   1/1  ldllregelDlairygppldpglvarplgeerlvlvaspdhpl.agrpltledL.aghplillsrgsglr
00457901   1/1  gelDlairygpppdppglvarplgeerlvlvaspdhplaagepltledL.aghplillsr...gsglrdl
00473131   1/1  gelDlairygplpdpglvarplgeerlvlvaspdhplahgepltledLa.ghplillsrgsglr...dll
00528061   1/1  gelDlairagpppldpglvarplgeerlvlvaspdhplahgepltledLa.ghplillspgsglr...dl
00474621   1/1  egelDlairagplpdpglvarplgeerlvlvaspdhplahgepltledL.adhplillsrgsgpg.lrdl
00525091   1/1  egelDlaiaylpigplrdpglvseplfeeplvlvaspdhplagge.ltledlagyplilvspgsglrrll
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFPPPPKPVSLLYPDRRY
00499981   1/1  ...dlldralaaagleprivlevnsleallalvaaGlGiallpeslvaeelasgrlvalplplplpprpl
00457901   1/1  ldralaaagleprivlevnsleallalvaaGlGiallpeslvadela.grLvalplpdplpprplylvyr
00473131   1/1  dralaaagleprivlevnsleallalvaaGlGiallpeslvaeelasgrLvalplpdplpprplylvyrk
00528061   1/1  ldralaaaglrprivlevnsleallalvaaGlGiallpeslvadelasg.Lvalplpdplpprplylvyr
00474621   1/1  ldralaaagleprivlevnsleallalvaaGlGiallpeslva.elasg.lvalpldeplpprplylvyr
00525091   1/1  dealaeagl....kprialevdsleallalvaagdgiallprslaeellaagdlvvlplplplppreiyl
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LAPKVRVFIDWLCEVFGPDAHL------------------------------------------------
00499981   1/1  ylvwrkrrllspavrafidllre-----------------------------------------------
00457901   1/1  krrplspavrafidllreala-------------------------------------------------
00473131   1/1  rrllspavrafidllrealae-------------------------------------------------
00528061   1/1  krrllspavrafid--------------------------------------------------------
00474621   1/1  kr.llspavrafidllre----------------------------------------------------
00525091   1/1  vwrkrrllspavrwvr------------------------------------------------------
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------