[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67448.1


[Show Plain Result]

## Summary of Sequence Search
   1::566
  24::562    8e-23 35.7% 0037043 00370431 1/1   site domain of metallo-dependent hydrol 
  30::566  1.2e-12 30.5% 0047005 00470051 1/1   site domain of metallo-dependent hydrol 
  32::566  2.5e-12 30.9% 0047004 00470041 1/1   site domain of metallo-dependent hydrol 
  90::514  6.5e-12 18.6% 0047519 00475191 1/1   lo-dependent hydrolases                 
  31::562  1.1e-11 32.7% 0047518 00475181 1/1   site domain of metallo-dependent hydrol 
  31::563  1.4e-11 30.4% 0044456 00444561 1/1   site domain of metallo-dependent hydrol 
  30::558  2.4e-11 31.2% 0053092 00530921 1/1   site domain of metallo-dependent hydrol 
  24::559  1.2e-09 27.4% 0041948 00419481 1/1   site domain of metallo-dependent hydrol 
  30::89   7.4e-09 30.9% 0040833 00408331 1/1   site domain of metallo-dependent hydrol 
 347::528  4.3e-08 27.6% 0047865 00478652 2/2   lo-dependent hydrolases                 
 346::525  4.6e-07 26.1% 0039934 00399341 1/1   lo-dependent hydrolases                 
 347::524  5.5e-07 28.6% 0045709 00457092 2/2   lo-dependent hydrolases                 
 235::504  8.3e-07 18.6% 0051670 00516702 2/2   lo-dependent hydrolases                 
 323::525  3.9e-05 27.7% 0051799 00517992 2/2   lo-dependent hydrolases                 
  80::472  0.00015 21.3% 0052371 00523711 1/1   lo-dependent hydrolases                 
  32::89   0.00087 28.3% 0051378 00513781 1/1   site domain of metallo-dependent hydrol 
 324::516    0.041 19.9% 0053093 00530932 2/2   lo-dependent hydrolases                 
  52::99      0.15 36.6% 0047865 00478651 1/2   lo-dependent hydrolases                 
  75::98      0.16 41.7% 0045709 00457091 1/2   lo-dependent hydrolases                 
  90::187     0.18 19.4% 0053093 00530931 1/2   lo-dependent hydrolases                 
  78::98      0.25 61.9% 0051799 00517991 1/2   lo-dependent hydrolases                 
  87::178      1.3 25.6% 0051670 00516701 1/2   lo-dependent hydrolases                 
   1::566


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISLVPPLLSRTALLFLLTATGAATAARPAADIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
00370431   1/1  -----------------------mkisrlayadllgpttgdlvrladtdllaevekdltlygeelvfggg
00470051   1/1  -----------------------------mmdllikngrvvdpdgll..vadvliedgkIaaigedlsa.
00470041   1/1  -------------------------------dllikngtvvdpdg..llvadvliedgkIaaigenlea.
00475191   1/1  ----------------------------------------------------------------------
00475181   1/1  ------------------------------ldlliknalvltldddlledgdvlieggrIaavg......
00444561   1/1  ------------------------------mdlliknarivtpdg.viedgdvliedgkIaaigegllll
00530921   1/1  -----------------------------mfdllikngtvvdg.....lvadiaikdgkIaaigslle..
00419481   1/1  -----------------------vaaleesmllllkngrvvdp..gvlvkadvliadgkIaaigsnipad
00408331   1/1  -----------------------------mldllikngtvvdgtgglllaadvliedgrIvavgdlla..
00478652   2/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00516702   2/2  ----------------------------------------------------------------------
00517992   2/2  ----------------------------------------------------------------------
00523711   1/1  ----------------------------------------------------------------------
00513781   1/1  -------------------------------lyAltnarift.gdevledhavliedgkIkaivplael.
00530932   2/2  ----------------------------------------------------------------------
00478651   1/2  ---------------------------------------------------tdiknlPKvelhlhldgsl
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
00370431   1/1  kvlrdgmglsvaaademadlliknarivdgdg..ivkadiaikdGrIaaigkalepplldgvdlivgsat
00470051   1/1  ...peaaevidasgllvlP...................................................
00470041   1/1  ...pegaeviDatGllvlPGl.................................................
00475191   1/1  -------------------GlidtHtHldqtllrglaldl..............................
00475181   1/1  ..klpaaevidasgklvmP...................................................
00444561   1/1  ...laaaevidaegllvlP...................................................
00530921   1/1  ...asaaevidasGlllvlPG.................................................
00419481   1/1  l..lpgaevidasGklvlP...................................................
00408331   1/1  ...lsaaevidasGllvlP---------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00516702   2/2  ----------------------------------------------------------------------
00517992   2/2  ----------------------------------------------------------------------
00523711   1/1  ---------ldgkvrTvlGpidpdelglvdtHeHLlvdl.....fgvyldplllld..............
00513781   1/1  ...pagaevidlgGalllP---------------------------------------------------
00530932   2/2  ----------------------------------------------------------------------
00478651   1/2  spetllelaikngiilplgt.......le-----------------------------------------
00457091   1/2  ----tdflknPKvelhlhldgslspetl------------------------------------------
00530931   1/2  -------------------GlIDtHvHliepfletleevleaalaaGVttvvdaggtglenfeamlelae
00517991   1/2  -------dllnvlkvdtllllldlmnqs------------------------------------------
00516701   1/2  ----------------llpgliDaHvHl..............ddpgfdedleevlarakaagvttivvvg


                         +         -         -         -         -         *         -:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
00370431   1/1  eviDaeGkivtPG.........................................................
00470051   1/1  ......................................................................
00470041   1/1  ......................................................................
00475191   1/1  ......................................................................
00475181   1/1  ......................................................................
00444561   1/1  ......................................................................
00530921   1/1  ......................................................................
00419481   1/1  ......................................................................
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00516702   2/2  ----------------------------------------------------------------------
00517992   2/2  ----------------------------------------------------------------------
00523711   1/1  ......................................................................
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  kyplrvlaflnisvvglhpldflgdgdeltleelaelikvvaigeiG-----------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  tdledfekllelaekypnvyaalGvhplevdelaeevl--------------------------------


                         -         -         -         +         -         -         -:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
00370431   1/1  ......................................................................
00470051   1/1  ......................................................................
00470041   1/1  ......................................................................
00475191   1/1  ..sllewlelytfplealltpedlyaaallallellrsGvttvedfgtlh..........dalaeaaeel
00475181   1/1  ......................................................................
00444561   1/1  ......................................................................
00530921   1/1  ......................................................................
00419481   1/1  ......................................................................
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00516702   2/2  ------------------------llpgliDaHvHlddpgfdedleevlarakaagvttivvvgtdledf
00517992   2/2  ----------------------------------------------------------------------
00523711   1/1  ..........................teldlvelaleeleellaaGvttivdvttlglgrdllllleiae
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
00370431   1/1  ......................................................................
00470051   1/1  ......................................................................
00470041   1/1  ......................................................................
00475191   1/1  giravlglvlmdrpppd.....alsleealelleealg.agglvvvg.laphspytvsp.....ellrav
00475181   1/1  ......................................................................
00444561   1/1  ......................................................................
00530921   1/1  ......................................................................
00419481   1/1  ......................................................................
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  ------------------------------------------------------------------lyly
00399341   1/1  -----------------------------------------------------------------slkal
00457092   2/2  ------------------------------------------------------------------lrel
00516702   2/2  ekllelaekypnvyaalGvh......................plevdelaeevldeleelleelrpkvva
00517992   2/2  ------------------------------------------lalklgdlvvgidlvgae.fspellral
00523711   1/1  etginivaatGlypdafldvlalsveelaelvvkeieegad........gtgvkaGviGeigl.dgit..
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  -------------------------------------------vaigeiGLklfmdysavieaqkevlea
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
00370431   1/1  ......................................................................
00470051   1/1  ......................................................................
00470041   1/1  ......................................................................
00475191   1/1  lelarelglpvhiHlaetldev....rpvelleelgllgprtllaHcvhlsdeeiellaetgvvvvhcPt
00475181   1/1  ......................................................................
00444561   1/1  ......................................................................
00530921   1/1  ......................................................................
00419481   1/1  ......................................................................
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  relfelarelglpvtiHagEtgdeg.......glldalgllgad.rigHgvhltedelLidllaeagigv
00399341   1/1  felAekygllvdiHvdetldpgsrvletlaeiaealgllg.rvlisHatslsslseeeveellkllaeag
00457092   2/2  llafelarelglpvtiHagEtgd........plelldalgllgad.rigHgvhltedelLidllaeagig
00516702   2/2  iGeiGldyylsksplelqlevfraqlelakelglpviiHt..rdapedlleilke....lgldl.rvvl.
00517992   2/2  felarelglpvtiHagEtgglrp.....veyladalgllgadri..gHgvhltedelliellaeagiavv
00523711   1/1  pleekvlraaaeaaretglpvivHtsegteaglevleilaee....gvdpsrviigHldrtldpeyllal
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  alelakelkdlpvvvHvrda.........pedlleilelleegdiviHcfhgsaagilvaeeatllelal
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
00370431   1/1  ......................................................................
00470051   1/1  ......................................................................
00470041   1/1  ......................................................................
00475191   1/1  snlklgs...........giapvrelldaGvnvglgtDgpasnpsldmleemrlaalllrlrd......p
00475181   1/1  ......................................................................
00444561   1/1  ......................................................................
00530921   1/1  ......................................................................
00419481   1/1  ......................................................................
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  vvcPtsnlklgl.........vsgladhPvrelldaGvpvalgTD..dpgsfsgdlleeyrlaallfg..
00399341   1/1  isvvvl..PlsnlylqgredtvpvlrgvtpvkelldaGvnvslGsDnvaDpfypvgdgDmlevlelalri
00457092   2/2  lvvcPtsNlklglvsglak................hpvrelldaGvpvalgtD..dpasfgtdlleeyrl
00516702   2/2  Hcftgsleealalldlgvyisisgvvtf..............kraeelrellkaipldrllleTDaPyla
00517992   2/2  vcPtsNlklgl...............vsglakhpvrelldaGvpvalgtD..dpgsfgtdlleemrlaal
00523711   1/1  adlGvylgfdgigtfkynlllnlsalgdvdllsdeeraallrelveagyldr------------------
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  ealelGv..............yidigggstfknakalrealkigldrllleTDapyltp.........rn
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDRIDTIRAVLTLVDGRIVHESP
00370431   1/1  ......................................................................
00470051   1/1  .........................gslavGadADlvlvdpdalltvdaetllsklkntpfegleltgrv
00470041   1/1  .................................ADlvvvdpdalltisaelllskvdytpfegleltgrv
00475191   1/1  kalsaeealrmatlngaralgldd----------------------------------------------
00475181   1/1  .........................GsleeGklADlvlldldaphllplhnllshlvysangdvdtvivd
00444561   1/1  .........................GsievGkdADlvlldld...........llvlltivgGklvyddg
00530921   1/1  ...........................flevGkdaDltifdldpellllkdgvtplvglellglpvlt--
00419481   1/1  .........................GliepgkdADlvlldpdll...........veevivrGelvaad-
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  ........lspee.lkaatlnaaralglddeigslevg--------------------------------
00399341   1/1  aqllgkm..................sleellalvT-----------------------------------
00457092   2/2  aallfg..........lspee.lkaatlnsakal------------------------------------
00516702   2/2  plpyrgkrnepayl--------------------------------------------------------
00517992   2/2  lfg..........lspeellela.lngaralgldd-----------------------------------
00523711   1/1  ----------------------------------------------------------------------
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  epvysllvalslalllgisleevvel--------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DLNAGQ----------------------------------------------------------------
00370431   1/1  ..--------------------------------------------------------------------
00470051   1/1  vativr----------------------------------------------------------------
00470041   1/1  vativn----------------------------------------------------------------
00475191   1/1  ----------------------------------------------------------------------
00475181   1/1  Gk--------------------------------------------------------------------
00444561   1/1  ell-------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00516702   2/2  ----------------------------------------------------------------------
00517992   2/2  ----------------------------------------------------------------------
00523711   1/1  ----------------------------------------------------------------------
00513781   1/1  ----------------------------------------------------------------------
00530932   2/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00530931   1/2  ----------------------------------------------------------------------
00517991   1/2  ----------------------------------------------------------------------
00516701   1/2  ----------------------------------------------------------------------