[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67603.1


[Show Plain Result]

## Summary of Sequence Search
   1::146
   1::132    9e-29 31.2% 0050863 00508631 1/1   like                                    
   1::146


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTFTGRCLCGQSHFTVDVEMLDVYACHCTLCQKWSGGIAMYLEACGQPQLAPLSPEPPYFSSSSRGERY
00508631   1/1  lllldlllvllhplvdlgilllsesfmgmtltGsClCGaVrfevtgepllvhlChCsdCrkasGsafaan


                         -         -         *         -         -         -         -:140
query           FCSGCGCPLWFRLTDTDRYFIPWTLLELNEVDRRRLILAAEIYTETQPAFWRLTGQYARLSGKEVEEMDS
00508631   1/1  avvprddvtvtsgedklkvydsgsgarryfCstCGshlfgrledadllfpglvfvraglldd--------


                         +         -         -         -         -         *         -:210
query           PCQLAH----------------------------------------------------------------
00508631   1/1  ----------------------------------------------------------------------