[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67677.1


[Show Plain Result]

## Summary of Sequence Search
   1::220
  33::193    2e-62 50.3% 0052777 00527771 1/1   Nqo6-like                               
  49::191  4.1e-42 42.0% 0035907 00359071 1/1   Nqo6-like                               
  45::176  5.5e-42 43.2% 0038382 00383821 1/1   Nqo6-like                               
  49::176  2.2e-41 45.3% 0036735 00367351 1/1   Nqo6-like                               
  48::176  8.4e-41 44.2% 0037747 00377471 1/1   Nqo6-like                               
  48::176  5.2e-40 42.6% 0045287 00452871 1/1   Nqo6-like                               
   1::220


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
00527771   1/1  --------------------------------elegvlltllddllnwarlsslwvltfglaccaiElla
00359071   1/1  ------------------------------------------------krlkvlwlllggcsGCsislld
00383821   1/1  --------------------------------------------llnlkrlkvlwlllggcsGCsislld
00367351   1/1  ------------------------------------------------krlkvlwlllagcsGCsislld
00377471   1/1  -----------------------------------------------kgrlkvlwlllggcsGCsislld
00452871   1/1  -----------------------------------------------kkrlkvlwlllggcsGCsislld


                         -         -         *         -         -         -         -:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
00527771   1/1  llaprydlerfgievfvasPrqaDvllvtGtvtlkmapalkrlyeqmpePklvialGacAisGGifdsya
00359071   1/1  lleplldllrlgliellyhptlmaasglqaeelledavasprgadvllveGsvtlkmaglyllvgsgrgd
00383821   1/1  lleplldllrlglielvyhptlmaakglqaeellvfvasprgadvllveGsvtlkmnglylllggrpale
00367351   1/1  lleplldllrlglielvyhptlmaakgelaeellvlvasprgadvllveGavtlkmaglylllggrpale
00377471   1/1  lleplldllrfgliellyhptlmaaageqaeelledvasprgadvllveGsvtlkmaglylllggrpale
00452871   1/1  lleplldllrlglielvyhptlmaasglqaeellvasprgadvllveGsvtlkmaglylllggrpalell


                         +         -         -         -         -         *         -:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIA
00527771   1/1  vvggvdkvipvdvyipGcPPrPealldgllallekiekelllellllkeelaa-----------------
00359071   1/1  llllggrpvlellyelapeakaviAvGtCAayGGifaarnnptvaeglsvv-------------------
00383821   1/1  llyelapkakaviAvGtCAvsGGifaagnnptdayg----------------------------------
00367351   1/1  llyelapkakaviAvGsCAvsGGipaagnnptdayg----------------------------------
00377471   1/1  llyelapeakaviAvGtCAayGGifaagnnytvvvg----------------------------------
00452871   1/1  yelapkakaviAvGtCAvyGGifaagnnptdalgvv----------------------------------


                         -         -         -         +         -         -         -:280
query           VTNLRTPDEI------------------------------------------------------------
00527771   1/1  ----------------------------------------------------------------------
00359071   1/1  ----------------------------------------------------------------------
00383821   1/1  ----------------------------------------------------------------------
00367351   1/1  ----------------------------------------------------------------------
00377471   1/1  ----------------------------------------------------------------------
00452871   1/1  ----------------------------------------------------------------------