[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67703.1


[Show Plain Result]

## Summary of Sequence Search
   1::295
 181::288  4.5e-08 30.5% 0043518 00435182 2/2   drug resistance efflux transporter EmrE 
  46::144  1.5e-06 27.3% 0043518 00435181 1/2   drug resistance efflux transporter EmrE 
   1::295


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
00435182   2/2  ----------------------------------------------------------------------
00435181   1/2  ---------------------------------------------lrlllaallllpfalllklspgrtw


                         -         -         *         -         -         -         -:140
query           RLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQ
00435182   2/2  ----------------------------------------------------------------------
00435181   1/2  llllllgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvl


                         +         -         -         -         -         *         -:210
query           DMSHVDLTGAALALGAGACWAVYILTGQRAGAEHGPATVAVGSLIAAIIFVPIGAVQAGDALWHWSILPL
00435182   2/2  ----------------------------------------lrlllaallllpfalllk...lspgrtwll
00435181   1/2  llll------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGST
00435182   2/2  llllgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvlll
00435181   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTIRREPQIKQVDVK-------------------------------------------------------
00435182   2/2  llggrrrk--------------------------------------------------------------
00435181   1/2  ----------------------------------------------------------------------