[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67711.1


[Show Plain Result]

## Summary of Sequence Search
   1::404
   1::253  3.4e-62 32.8% 0036364 00363641 1/1   ase-like                                
 214::404  3.8e-60 45.5% 0049676 00496761 1/1   ase-like                                
   1::251  4.3e-58 34.3% 0036782 00367821 1/1   ase-like                                
   2::253  2.6e-56 34.3% 0053134 00531341 1/1   ase-like                                
 213::404  2.9e-56 45.3% 0044094 00440941 1/1   ase-like                                
   1::251  3.4e-55 33.9% 0052890 00528901 1/1   ase-like                                
   1::251  3.5e-54 32.7% 0039353 00393531 1/1   ase-like                                
   1::251  1.2e-53 34.0% 0042062 00420621 1/1   ase-like                                
 254::406    2e-49 45.8% 0036365 00363651 1/1   ase-like                                
 252::405  3.5e-46 45.1% 0042063 00420631 1/1   ase-like                                
 252::405  5.4e-45 44.8% 0036783 00367831 1/1   ase-like                                
 252::404  1.3e-44 42.5% 0052891 00528911 1/1   ase-like                                
 254::404  1.8e-43 43.0% 0053135 00531351 1/1   ase-like                                
   1::403  2.4e-42 29.9% 0049604 00496041 1/1   ase-like                                
   3::211  4.5e-42 30.6% 0044095 00440951 1/1   ase-like                                
   2::210  1.4e-41 29.0% 0044093 00440931 1/1   ase-like                                
 252::404  1.9e-41 43.4% 0039354 00393541 1/1   ase-like                                
  52::321  3.6e-37 30.7% 0035032 00350321 1/1   ase-like                                
  56::309  3.2e-29 28.1% 0048944 00489441 1/1   ase-like                                
  61::318  3.5e-29 30.8% 0050445 00504451 1/1   ase-like                                
   1::248    3e-27 32.8% 0038812 00388121 1/1   ase-like                                
 226::403  1.5e-20 33.3% 0038813 00388131 1/1   ase-like                                
   1::248  2.4e-20 27.6% 0041153 00411531 1/1   ase-like                                
 250::404    7e-20 32.5% 0044962 00449621 1/1   ase-like                                
   4::245  1.1e-18 30.3% 0044256 00442561 1/1   ase-like                                
 251::404  1.4e-18 29.4% 0042745 00427451 1/1   ase-like                                
 249::401    3e-15 27.3% 0035033 00350331 1/1   ase-like                                
  56::359  1.1e-09 23.2% 0049939 00499391 1/1   ase-like                                
   2::245  9.4e-09 26.5% 0047209 00472091 1/1   ase-like                                
 226::403  1.1e-07 20.0% 0044257 00442571 1/1   ase-like                                
 226::403  4.3e-05 21.8% 0041154 00411541 1/1   ase-like                                
   1::404


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
00363641   1/1  mervaivgmgvrtPgglsleelwdlllagrsgireipafrldglyvrvagfldfdaaffisprearamdp
00496761   1/1  ----------------------------------------------------------------------
00367821   1/1  mervaivgmgvrtPggngleefwelllagrsgiseipafrldglyvrvggflddfdaaffisprearamd
00531341   1/1  -ervaitGmgcrfPggnsleefwelllagrsgireipefrwdldllydpddavivgalrtpiggflddld
00440941   1/1  ----------------------------------------------------------------------
00528901   1/1  mervaivgmgvrtPlglgleefwelllagrsgireipafrldglyvrvggflddfdaffgisprearrmd
00393531   1/1  mervaIvgmgvrtPggvglgelwdlllagrsgireipafrldglyvrvggfldfdaaffisprearamdp
00420621   1/1  eslldlmmepvaIvgmgvrtPgglgleefwelllagrsgireipafrldglyvrvggflddfdaffgisp
00363651   1/1  ----------------------------------------------------------------------
00420631   1/1  ----------------------------------------------------------------------
00367831   1/1  ----------------------------------------------------------------------
00528911   1/1  ----------------------------------------------------------------------
00531351   1/1  ----------------------------------------------------------------------
00496041   1/1  lllelsrdepvaivegmgcrfPglavsleefwelllegrdaiseipavrilllgsylpdr.yvtngglld
00440951   1/1  --rvvitGmgvvlPlgvgveefwelllagrsgiseipafrwdglpvrvagflddfdpffgisprearamd
00440931   1/1  -ervaIvGmgvrtPggngleefwelllagrsgireipafrldrfggflagvvpfdaaffgisprearamd
00393541   1/1  ----------------------------------------------------------------------
00350321   1/1  ---------------------------------------------------lllllggfmddvvivgfdr
00489441   1/1  -------------------------------------------------------dvvivdaartpigkr
00504451   1/1  ------------------------------------------------------------lllmrdvviv
00388121   1/1  mslllllllmrrvvivgigvylPlgvvtneeladllggssg...................kilertgigs
00388131   1/1  ----------------------------------------------------------------------
00411531   1/1  llllllmrpvaIvgigvylPggvvsneelwell...................gtsdefiavrtgigerrg
00449621   1/1  ----------------------------------------------------------------------
00442561   1/1  ---vvIlglgsylPegvvtneeleklld...................tsdewilartgilerrialkdet
00427451   1/1  ----------------------------------------------------------------------
00350331   1/1  ----------------------------------------------------------------------
00499391   1/1  -------------------------------------------------------dvvivgaartpigkr
00472091   1/1  -epvgIlgigvylPelvvtneelaell...................gtsderilartgikerrvalpded
00442571   1/1  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
00363641   1/1  qqrlaleaarealedagldpeelddgsrtGvivGsvlggylllnlarlaallaglpesvspylltgllln
00496761   1/1  ----------------------------------------------------------------------
00367821   1/1  pqqrlaleaawealedagldped.ldgvrvGvvvgsglggyla.leaallallekgprrvspylltgtla
00531341   1/1  llsafdalffgisprmdpqqrlaleaawealedagldpeelldgsrtgvvvgsglggyealeaalralll
00440941   1/1  ----------------------------------------------------------------------
00528901   1/1  pqqrlaleaawealedagldpedl.dgsrtGvvvgsglggylaleaalrall.lkglrrvspylltgtll
00393531   1/1  qqrlaleaareAledagldped.ldgvrvGvvvgsglgg.ylarlaallaglprgprrvspylltgtlln
00420621   1/1  rearamdpqqrlaleaawealedagldpee.ldgvrvGvvvgsglgg.ylarlaallaglpkgpelvspy
00363651   1/1  ----------------------------------------------------------------------
00420631   1/1  ----------------------------------------------------------------------
00367831   1/1  ----------------------------------------------------------------------
00528911   1/1  ----------------------------------------------------------------------
00531351   1/1  ----------------------------------------------------------------------
00496041   1/1  dvdefdaartgispreaalmdeaqrlaleaarealedagldpedid.....gvivgtvtg..........
00440951   1/1  pqqrlaleaaweAledAgldpesldg.srtGvfvGsgiggyetleealllll.ekgprrvspylltgtlp
00440931   1/1  pqqrlaleaareAledagldpee.ldgvrvGvvvgsglgg.ylaleaallallpkglllellprrvspyl
00393541   1/1  ----------------------------------------------------------------------
00350321   1/1  tpfgksprgalamdpaqdlaleaarealedaplslgldpee.vddvivGvvlgaglggn...........
00489441   1/1  rgaladdpaadlaaeaarealeragldpe.dvddvivGvvlgagqgpn......................
00504451   1/1  gadrtpfgksprgalamdpaqrlaleaakealedlagldpedv.ddvivGvvlgaglqgy..........
00388121   1/1  rrgalvferavdlaaeaarealedagldpedid.....gvivgtatggi.....................
00388131   1/1  ----------------------------------------------------------------------
00411531   1/1  aladepavdlaleaarealedagldpedid.....gvivgtvtgdy........................
00449621   1/1  ----------------------------------------------------------------------
00442561   1/1  tsdlalaaarealedagldpedidlvivg................................tvtpdyllp
00427451   1/1  ----------------------------------------------------------------------
00350331   1/1  ----------------------------------------------------------------------
00499391   1/1  rgaladvsasdLaaeaarealeragldpedid.....lvivGtvlpdglqgpnlarlaalalg.......
00472091   1/1  asdlaleAareaLedagldpddid.....lvivgtvtgdyllps..........................
00442571   1/1  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
00363641   1/1  vlagrvsyllglrGpaltvdtacaSslvAihlAaqairsGeadvalaGGveslsplplvgfsalgalslt
00496761   1/1  ----------------------------------------------------------------------
00367821   1/1  nvlagrisyllglrgpsltvdtacsSslvAlhlAarllrsgeadvalaGGvelmlspltlvgfsalgals
00531341   1/1  .kglrrvspylltgtllsvlagrvsyllglrgpaltvdtaCsSslvAihlAaqairsGeadvalaGGvel
00440941   1/1  ----------------------------------------------------------------------
00528901   1/1  nvlagrisyllglrgpsltvdtacsSslvAihlAaqalrsgeadvalaGGvelmlspltllgfsalgals
00393531   1/1  vlagrisyllgltgpaltvdtacsSglvAlhlAaqairsGeadvalagGvesmssppllagfsamgalse
00420621   1/1  lltgtllnvlagrvsyllglrgpaltvdtacsSslvAihlAaqairsGeadvalaGGvesmlspptllgf
00363651   1/1  ----------------------------------------------------------------------
00420631   1/1  ----------------------------------------------------------------------
00367831   1/1  ----------------------------------------------------------------------
00528911   1/1  ----------------------------------------------------------------------
00531351   1/1  ----------------------------------------------------------------------
00496041   1/1  ..................allpslaarvalllglppngpaftvdtagCssglvAlhlAaqlirsgeadva
00440951   1/1  svaagrisyllglrGpsltvdtacasslvAiglAaralrsGe.dvalaGGvelllspltlagfsalgals
00440931   1/1  ltgtlpnvlagrvsyllglrgpaltvdtaCsSglvAihlAaqairsGeadvalaGGvelmlspltlagfs
00393541   1/1  ----------------------------------------------------------------------
00350321   1/1  ....................iarraallaglpvsgpaltvntaCsSglvAihlAaqairaGeadvalAgG
00489441   1/1  .......iarrvalalglpvggpaftvnraCaSglqAialAaqairsGeadvvlagGvesmsrapllldr
00504451   1/1  ....................nlarraalllglpvsgpaltvdtaCsSglvAvhlAaqairsGeadvalag
00388121   1/1  ......lgpslaaavalrlglpgvpavtvstaCasglaalplAadlirsgradvvlvvgaeamslp....
00388131   1/1  ----------------------------------------------------------------------
00411531   1/1  ...alpslaarvalllglpgvpafdvdtaCasglaalalAadlirsgeadvvLvvgvelmsrp.......
00449621   1/1  ----------------------------------------------------------------------
00442561   1/1  ataalvalrlglngpafdvnaaCasglyAlalAaalirsgladvvLvggaealsrll.............
00427451   1/1  ----------------------------------------------------------------------
00350331   1/1  ----------------------------------------------------------------------
00499391   1/1  ..................lplgvpaftvnraCsSglvAlhlAaqairsGeadvvlagGvesmsrvpllld
00472091   1/1  .laarvaallglrgapafdvnaaCasglaALalAaqlirsgladraLvvgaellslgl............
00442571   1/1  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
00363641   1/1  lnddpdgacrpfdadadgfvlgeGaaalvLerledAlargaki---------------------------
00496761   1/1  ---spdgacrpfdadadGfvlGeGagalvLerledAlargarpilavilgsavnsdgaglt.psglgqar
00367821   1/1  t.rndlpdgacrpfdadadgfvlgeGagalvLerledAlar-----------------------------
00531341   1/1  mlspltllgfsalgalsgdlndeplgacrpfdadadGfvlgeG---------------------------
00440941   1/1  --lspdgacrpfdadadGfvlgeGaaalvLerledAlargarilavilgyavnsdgaslsltapsgegqa
00528901   1/1  t.rndlpdgacrpfdaaadGfvlgeGagalvLerledAlar-----------------------------
00393531   1/1  .lvadpdgasrpfdedadgfvlgeGaaalvLesledAlarG-----------------------------
00420621   1/1  salgalst..nddpdgacrpfdadadGfvlgeGaaalvLer-----------------------------
00363651   1/1  -------------------------------------------yavilgygvnsdgagitaPsgegqara
00420631   1/1  -----------------------------------------riyavilgygvnsdgaslsltaPsgegqa
00367831   1/1  -----------------------------------------riyavilgygvnsdgaslsltaPsgegqa
00528911   1/1  -----------------------------------------riyAvilgsavnsdgrsisltaPsgegqa
00531351   1/1  -------------------------------------------yAvilgsgvnsdgrsigltaPsgegqa
00496041   1/1  Lvggvelmsraldpegfaslvalsalfgdg...acavfltaadgsvlgegagavvlkslsdalrdgdril
00440951   1/1  p---------------------------------------------------------------------
00440931   1/1  ----------------------------------------------------------------------
00393541   1/1  -----------------------------------------rilAvivgyavnsdgpsisitaPsglgqa
00350321   1/1  vesmsrapllllgplllvdlsllrals......pagasrpfgataegvargegigrevldelAlkshqra
00489441   1/1  .......rtgalfgdgarafdleadglvlgegaglmgltaeelalrygisredqdafalrshiraaaaga
00504451   1/1  Gvesmsrpplllgfdalgalsldgrltpl.lmgltaenvaekygisreeqdafAlkshcrafdapadgff
00388121   1/1  ...................rdfddardgslfgdGAaal--------------------------------
00388131   1/1  ---------------gdgflfgdGAaavvLesleaaralglrilavivglamdgre..vpapavealaea
00411531   1/1  ................rdfddaadgslfgdGAaavvle--------------------------------
00449621   1/1  ---------------------------------------Glkplarivgyavagda...papmglgpvlA
00442561   1/1  ..........dfddrrtgflfGdGAgavvLeelee-----------------------------------
00427451   1/1  ----------------------------------------lkplarivgyavagda...palmglgpvlA
00350331   1/1  --------------------------------------rglkplarivgyavagdd...palmglgpvlA
00499391   1/1  r.......alfgdgagavllfdaladglllaeglgdpvlkrlmgatae...nvaek..ygisreeqdafa
00472091   1/1  ...........dfddrltgalfgdGAaavvlerde-----------------------------------
00442571   1/1  ---------------gnaslfgdGAaAvllesdegaralglrplargllvalgrdvpklaltalveaire
00411541   1/1  ---------------gnaslfgDGAaAvvleseedarglgllplatig..llamlgrdvpklavaalvpa


                         -         *         -         -         -         -         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
00363641   1/1  ----------------------------------------------------------------------
00496761   1/1  airaaladagldpedidyveahgtgtplgdpiEalalaavfgedplpvgsvksniGhllgAaGaaelika
00367821   1/1  ----------------------------------------------------------------------
00531341   1/1  ----------------------------------------------------------------------
00440941   1/1  rairaaladaglspddidyveahgtgtplgdpiEalallrvfgldadpllvgsvksniGhllgAaGaael
00528901   1/1  ----------------------------------------------------------------------
00393531   1/1  ----------------------------------------------------------------------
00420621   1/1  ----------------------------------------------------------------------
00363651   1/1  irlaladagldvdyveahGtGTplgDpiElealaavfgdnpllvgsvKsniGHllgAaGaaelikvllal
00420631   1/1  rairlaladagldpedvdyveahGtgTplgDpiEaaalaavfgdp.llvgsvKsniGhllgAaGaaelik
00367831   1/1  rairaaladagldpedvdyveahGtGTplgDpiEaealkavfgdragpllvgsvKsniGhllgAaGaael
00528911   1/1  rairaaladagldpddvdyveahGtGtplgDpiElaalarvfgdradpllvgsvKsniGhllgaaGaael
00531351   1/1  rairaaladagldpedvdyveahGtGtplgDpiElealkavfggraadnpllvgsvKsniGhllgAaGaa
00496041   1/1  avirgsavngdglgkgvpapagegqarairkaleragldpddidyveahgtgtalgdaie..kalgldpe
00440951   1/1  ----------------------------------------------------------------------
00440931   1/1  ----------------------------------------------------------------------
00393541   1/1  rairkaladagldpddidyveahgtgTplgDaaealallrvfgldaeplnvgsvksniGHllgAaGaael
00350321   1/1  aaaedagafgdeivpvivgsgvnvdgdeitrpdttleg...-----------------------------
00489441   1/1  agffdgeivpvtvpdgkgqarvirdalar-----------------------------------------
00504451   1/1  rgegvpvvvlkrledaladgddil.vrrgttleslgkl--------------------------------
00388121   1/1  ----------------------------------------------------------------------
00388131   1/1  irkalekagltpddidyvelhqagtrildavekkl........glppekvkvntghplGntgaaslplal
00411531   1/1  ----------------------------------------------------------------------
00449621   1/1  irkalkraglspddidlvelheaftal.dlaelealglvlg.gplpvnvsGgaialGhplgasGarllve
00442561   1/1  ----------------------------------------------------------------------
00427451   1/1  irkaleraglspddidlvelheaftaq.dlaelealgl....grlpvnvsGgaialGhplgAsGarllvt
00350331   1/1  irkalekaglspddidlielheafaaqvlaal..ealgldle.kvnvsGgalalGhplgasGarllvell
00499391   1/1  vkshrraaaaikaglfkaeivpvdvpdrkgdvvvahdegirigttlekllklkpvfvpdg..tvtagnas
00472091   1/1  ----------------------------------------------------------------------
00442571   1/1  alekagltpddidlfvlhqanaaildava.....kklglppekv....rvnlhpyGntgaasiplalael
00411541   1/1  irkalekagltlddidlfvlhqagarild.....avakklglppekvnvlgliayGntssAsiplalael


                         -         -         -         -         *         -         -:420
query           EHGFIAPSINIEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKL----------------
00363641   1/1  ----------------------------------------------------------------------
00496761   1/1  llalrhgvipptlnleepnpeidlllvpleprplplrralvnsfgfgGtnahlv----------------
00367821   1/1  ----------------------------------------------------------------------
00531341   1/1  ----------------------------------------------------------------------
00440941   1/1  ikallalrhgvipptlnldepnpeidlllvltearpwplrralvnsfgfgGtna----------------
00528901   1/1  ----------------------------------------------------------------------
00393531   1/1  ----------------------------------------------------------------------
00420621   1/1  ----------------------------------------------------------------------
00363651   1/1  rhgvipptlnldepnpeidlllvltearpwplrralvnsfGfgGtnahlvleeape--------------
00420631   1/1  allalrhgvipptlnldepnpeidlllvltearpwplrralvnsfGfgGtnahlv---------------
00367831   1/1  ikvllalrhgvipptlnldepnpeidlllvltearpwplrralvnsfGfgGtnah---------------
00528911   1/1  ikallalrhgvipptlnldepnpeidldlvpllvprelrlrralvnsfGfgGtn----------------
00531351   1/1  elikallalrhgvipptlnldepnpeidldlvpllvprelelrralvnsfGfgG----------------
00496041   1/1  kvnvsgsvksniGhtlgAsgalali...lllregrlpp...............-----------------
00440951   1/1  ----------------------------------------------------------------------
00440931   1/1  ----------------------------------------------------------------------
00393541   1/1  iklllalrhgvipptlnldepnpei.dldlvpeprplglrralvnsfgfgGtna----------------
00350321   1/1  ----------------------------------------------------------------------
00489441   1/1  ----------------------------------------------------------------------
00504451   1/1  ----------------------------------------------------------------------
00388121   1/1  ----------------------------------------------------------------------
00388131   1/1  lallregrlkpg........................drvlllgfGaGltngal-----------------
00411531   1/1  ----------------------------------------------------------------------
00449621   1/1  lllqLrgr...........................ggrrglasscggggtgaal----------------
00442561   1/1  ----------------------------------------------------------------------
00427451   1/1  lllalrgr...........................ggrralatlcggggqgaal----------------
00350331   1/1  lqLrggalglav..........................lciggGfgganvv-------------------
00499391   1/1  gisdGAAav-------------------------------------------------------------
00472091   1/1  ----------------------------------------------------------------------
00442571   1/1  lrrgrlkpg........................drvlllafGsGltagaavlr-----------------
00411541   1/1  lregrlkgg.............................dlglllafGaGltva-----------------