[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67784.1


[Show Plain Result]

## Summary of Sequence Search
   1::242
   5::223    3e-65 38.2% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   3::225    2e-63 43.0% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   3::241  2.8e-63 39.8% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   3::226  5.1e-63 43.0% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   3::224  5.3e-63 39.6% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   1::241  7.6e-63 39.7% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   3::243  3.3e-61 39.2% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   3::225  3.7e-61 41.1% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   3::242  2.1e-60 39.5% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   3::242  4.9e-60 40.3% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   1::238  5.1e-60 42.1% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   3::242  5.9e-60 44.7% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   3::224  1.1e-59 41.2% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   3::225  3.2e-59 41.5% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   3::226  1.6e-58 39.2% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   3::224  2.6e-58 40.4% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   1::224    6e-58 42.7% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   3::224  1.1e-57 38.9% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   1::224  2.5e-57 40.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   8::224  2.8e-57 41.8% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   4::240  3.1e-57 40.2% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   3::224  8.6e-57 40.0% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   3::224  2.8e-56 39.9% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   3::215  2.9e-56 44.2% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   3::223  5.9e-56 41.5% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  11::224  1.2e-54 45.2% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   2::223  5.9e-54 41.7% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   3::228  1.6e-53 37.7% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   2::225    4e-52 45.4% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::223  4.4e-52 41.1% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   3::233  1.1e-51 44.3% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   2::210  1.5e-51 41.1% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   3::224  4.4e-51 40.1% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   5::224  3.9e-50 44.6% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   2::229  9.2e-49 42.0% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  26::228  9.4e-47 45.4% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   3::233  1.4e-46 39.0% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
  23::224  4.6e-46 42.5% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  15::199  8.6e-46 50.0% 0047552 00475521 1/1   arboxykinase-like                       
   2::223  2.4e-45 36.8% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   3::228  7.1e-45 41.0% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   3::224  7.5e-45 42.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  18::223  9.9e-45 43.8% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  15::225  1.1e-44 44.3% 0053253 00532531 1/1   arboxykinase-like                       
  13::222  4.3e-44 42.9% 0047841 00478411 1/1   arboxykinase-like                       
  28::187  9.9e-44 46.3% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  17::222    2e-42 34.2% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   3::230  2.1e-41 38.3% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  20::223  9.8e-41 40.6% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  26::223  3.2e-38 42.4% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   3::223  1.2e-37 37.8% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
   2::226  2.9e-37 37.1% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  26::219    6e-37 43.1% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  27::191  2.7e-36 41.6% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  27::194  3.1e-36 43.9% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  11::222  5.3e-36 35.8% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  12::225  2.7e-35 36.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  17::221  6.7e-35 35.9% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  13::201  2.1e-34 36.9% 0047844 00478441 1/1   arboxykinase-like                       
  26::206  9.9e-34 35.2% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   5::199  3.5e-33 38.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  22::173  4.4e-33 43.8% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  26::219  7.3e-33 34.1% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  28::221  6.4e-32 36.3% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  25::221  5.3e-31 36.8% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  27::222  5.8e-30 37.9% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   3::224  1.7e-29 33.1% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  29::221  2.9e-29 40.7% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  29::224  3.4e-29 34.0% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  27::220  5.3e-29 38.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  19::195  2.6e-28 37.3% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::131  7.5e-28 38.7% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  17::223  1.8e-27 28.7% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  31::227  1.8e-27 28.4% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  17::222  2.8e-27 29.1% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   3::234  5.2e-26 35.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  11::225  6.2e-26 28.8% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   8::215  8.6e-26 33.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  20::220  1.6e-25 27.2% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   4::221  2.4e-25 31.4% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  17::223  5.2e-25 27.5% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  27::199  2.2e-24 38.4% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   6::199  4.2e-24 31.1% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  27::206  4.2e-24 32.1% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  23::199  6.9e-23 36.2% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  26::223  1.9e-22 29.3% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  28::229  7.5e-22 30.8% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  29::223  3.4e-21 30.8% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  27::214  1.3e-20 42.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   6::240  6.2e-20 28.6% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  22::208  9.3e-20 27.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  12::219  1.1e-19 34.6% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  12::217  1.1e-19 31.3% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  15::216    7e-19 37.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  22::215  1.1e-17 31.5% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
   4::223  5.3e-17 25.1% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  27::216  2.7e-16 31.1% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  29::219  5.8e-16 24.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  15::224  6.4e-16 28.3% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  23::217  8.4e-16 27.1% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  22::197  9.6e-16 40.8% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  12::225  4.2e-15 30.1% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  11::215  1.3e-14 21.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  20::223    5e-14 25.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  26::206  2.7e-13 29.7% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  19::202    5e-13 35.7% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  28::173  5.6e-13 35.3% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   6::212  8.2e-13 27.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  29::202    1e-12 28.6% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  15::212  1.7e-12 33.1% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  27::192  2.7e-12 23.8% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  21::197  3.2e-12 26.8% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  11::202  7.2e-12 31.4% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  22::218    1e-11 28.6% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  17::223  1.4e-11 21.0% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  13::202  3.2e-11 28.5% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  26::215  8.8e-11 27.2% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  26::170    9e-11 28.9% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  28::213  1.3e-10 23.8% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  24::224  1.6e-09 23.1% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  21::212  1.2e-08 29.2% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   7::225  3.5e-08 21.5% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  24::206  3.5e-08 19.5% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  28::187  6.6e-08 29.2% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  23::206  7.9e-08 25.6% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  27::207    9e-08 25.4% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  28::187  9.4e-08 28.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  26::198  1.3e-07 25.7% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  16::216  1.6e-07 20.3% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  24::172    2e-07 24.8% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  29::169    4e-07 28.2% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  12::61   4.5e-07 40.8% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  11::202  1.4e-06 27.0% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  15::63   1.4e-06 42.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  28::175  1.8e-06 29.2% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  27::187  2.3e-06 26.1% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  24::197  6.2e-06 29.3% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  28::215  7.4e-06 26.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  26::207  1.6e-05 21.7% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  11::96     2e-05 29.1% 0044125 00441251 1/1   p containing nucleoside triphosphate hy 
  28::198  2.9e-05 30.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  28::206  4.5e-05 20.6% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
  21::197  9.2e-05 26.9% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  27::185  9.3e-05 23.6% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  27::207   0.0001 26.7% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  27::61   0.00016 45.7% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  13::48    0.0002 36.1% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  15::48   0.00023 35.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  30::176  0.00029 24.1% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   4::48   0.00034 29.3% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
  26::48   0.00094 43.5% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
   1::242


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
00390411   1/1  ----MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrg
00422801   1/1  --llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkl
00378981   1/1  --lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldg..ld
00367901   1/1  --lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlil
00379581   1/1  --lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00509431   1/1  M.lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdl
00500441   1/1  --lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgk
00475891   1/1  --lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00420701   1/1  --lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgld
00425571   1/1  --lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllals
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00361211   1/1  --plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvl
00490801   1/1  --llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalv
00510251   1/1  --lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeiva
00466971   1/1  --llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg..
00482201   1/1  --llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00502741   1/1  lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgls
00458601   1/1  --lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg.....
00482261   1/1  lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildls
00466931   1/1  -------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldg..kd
00404101   1/1  ---elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltals
00475991   1/1  --lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00530591   1/1  --llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagll
00436071   1/1  --pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla
00495371   1/1  --esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp.....e
00485451   1/1  ----------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltgg
00498251   1/1  -vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKT
00424961   1/1  --lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglld
00469451   1/1  -allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldg..
00500611   1/1  pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00372301   1/1  --yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasgg
00436511   1/1  -ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkG
00488521   1/1  --lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGe
00496111   1/1  ----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliigle..
00367481   1/1  -yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpa
00457311   1/1  -------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgd..dl
00468691   1/1  --lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrG
00485931   1/1  ----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi....
00475521   1/1  --------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdgdlv...
00495031   1/1  -lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplgg
00422141   1/1  --dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifl
00379601   1/1  --llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvldl
00448931   1/1  -----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla
00532531   1/1  --------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleg
00478411   1/1  ------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldgdlvrlgl
00381441   1/1  ---------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlg
00503371   1/1  ----------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpds
00437981   1/1  --lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldg
00468601   1/1  -------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra.
00414121   1/1  -------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilid
00464791   1/1  --lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkG
00371631   1/1  -mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllg
00477971   1/1  -------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsg.......
00515511   1/1  --------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidg
00515531   1/1  --------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidg
00462761   1/1  ----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.
00368501   1/1  -----------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGpp
00475371   1/1  ----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi....
00478441   1/1  ------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdddlvll..
00475381   1/1  -------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavls
00356411   1/1  ----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvk
00480471   1/1  ---------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeil
00426051   1/1  -------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdg...v
00533501   1/1  ---------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig.
00464411   1/1  ------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsv..lltgepvsg
00496571   1/1  --------------------------GkgelivllGpsGsGKsTlarlLagll.........ggsvldtg
00379961   1/1  --yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnl..s
00487021   1/1  ----------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllr
00512891   1/1  ----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv....
00493431   1/1  --------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprp
00508671   1/1  ------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvl
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00510561   1/1  ----------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGgl
00368571   1/1  ------------------------------llgvrllpplppklagllplagladgdglgvllGklldgv
00468951   1/1  ----------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgi
00437941   1/1  --lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsg....
00379261   1/1  ----------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGv
00434401   1/1  -------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr.
00490731   1/1  -------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp....
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLakl
00498531   1/1  ----------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGgl
00484101   1/1  --------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldi....
00477011   1/1  -----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelr
00532471   1/1  --------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvge
00451571   1/1  ----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl....
00498811   1/1  -------------------------kP.gkiigltGpsGsGKsTlarlLael.....gvividgddlt..
00405881   1/1  ---------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvv
00480441   1/1  ----------------------------rlivllGpsGaGKsTlaklLaell.p..glivisvg..dttr
00499191   1/1  --------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..........
00489571   1/1  -----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00470731   1/1  ---------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTla
00392701   1/1  -----------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd.......
00406781   1/1  -----------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase.......
00404191   1/1  --------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakal
00511381   1/1  ---------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilv.kdaidtr
00439861   1/1  ---kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle....
00489631   1/1  --------------------------MkgklillvGppGsGKtTlaraLaellglpf........iridg
00513761   1/1  ----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparan
00513251   1/1  --------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr...
00499331   1/1  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl.....glpfidtddll
00432181   1/1  ---------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgv
00444381   1/1  -----------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrl
00527261   1/1  ----------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel....g
00480251   1/1  -------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllid..lDpy
00402371   1/1  -------------------------rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrld
00420941   1/1  ------------------lglslgirpgkgvllyGppGtGKTtlakalagel..gapfiridg.......
00515351   1/1  ---------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllreav.
00367291   1/1  -----vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..g
00394721   1/1  ----------------------------rnvlLvGppGvGKTtlakalakelaagsgpilldgvpv....
00386741   1/1  --------------lealkavllgirpgehllLvGppGtGKTtlaralagel.ga...............
00378841   1/1  --------------------------kelkillvGdsgvGKstLlnrllgdefiveyiptigvdvytktv
00517691   1/1  --------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.......
00437921   1/1  ----------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarll
00533151   1/1  ---------------------MsldikkgklivltGppGsGKtTlarlLaerlglpfistddllrelvpg
00482551   1/1  ----------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelg
00437901   1/1  ------------slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLy
00457851   1/1  -------------------------PkgklivltGppGsGKtTlakaLaerl...............glp
00461621   1/1  -------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly.......
00496061   1/1  ---------------------------gklivltGppGsGKtTlaklLaerlglpv.istddllre....
00472911   1/1  -----------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglage
00521551   1/1  --------------------lslglrpgkgvlLvGppGtGKTtlaralagll..gapfvrlsas......
00416171   1/1  ------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte
00478391   1/1  -----------------------msikkgklilltGppGsGKtTlaralaerl...........glpvid
00482721   1/1  ---------------------------kgkiigltGpsGsGKsTlarlLael...........glpvidt
00489391   1/1  ----------------------lsikkgklivltGppGsGKtTlakaLaerl.....glpvistddllre
00487061   1/1  --------------------------ldMkkgklIvieGppGsGKtTlakaLa..............er.
00476071   1/1  ---------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll.
00430121   1/1  -------------------------rpggnvllvGPpGvGKTtlakalagllfpsgvp....firinlse
00410531   1/1  ---------------gelknlslelkkglkillvGlngvGKTtllkrlag....................
00516041   1/1  -----------------------mlk.gklillvGppGsGKtTlaralaeel....glpfvvidaddl..
00469161   1/1  ----------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltre.....d
00410321   1/1  -----------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp.eygpti---------
00473941   1/1  ----------vvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.........
00495771   1/1  --------------kgalldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdg-------
00478081   1/1  ---------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidt......
00457881   1/1  --------------------------mgklivltGppGsGKtTlaklLaerl...............glp
00401211   1/1  -----------------------elkrglnvgivGhvgaGKSTLlnaLlgll..................
00493171   1/1  ---------------------------mgklivllGpsGaGKsTlaklLaeklglivlsvgdttr.....
00477561   1/1  -------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr.
00441251   1/1  ----------figflealknilkgipkknclllyGPpgtGKstlakalagllggtvlsvnnsnlnfwlad
00418301   1/1  ---------------------------gknvlLvGppGtGKTtlaralakll.gr...............
00483811   1/1  ---------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellrg
00409841   1/1  --------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv
00477721   1/1  --------------------------kpklilltGppGsGKttlaraLaeel.....glpfidtddllre
00519581   1/1  --------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaell...
00403151   1/1  --------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyipti---------
00378621   1/1  ------------glklllrrlslllkkglkvllvGlpgvGKstllnrl----------------------
00471271   1/1  --------------prailelesliksllekllellkrlslklkkglk----------------------
00509891   1/1  -----------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgr
00470231   1/1  ---elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrl----------------------
00512061   1/1  -------------------------kkkkgklivltGppGsGKtTlak----------------------


                         -         -         *         -         -         -         -:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQALARAEKLLERLRLKPYSDRYPL
00390411   1/1  adkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgi
00422801   1/1  lagllkptsGeilldgldilalslae......lrrrigyvfqdpalfp.ltvrenlalglllallllgls
00378981   1/1  llllslaelllllrrgigyvfqdpalfpgltvrenlalgllla.glskaeaaaraaellellglddlldr
00367901   1/1  kgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdi......slldlrelrrligyvpqd
00379581   1/1  talslael.....rrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervle
00509431   1/1  iflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi......slldlrelr
00500441   1/1  dildlsl........lrrgigyvfqdpalfpgltvlenlllgll.llglslaeaaeralelllllgledl
00475891   1/1  dilgls.....llellrrgigyvfqdpalfpgltvlenlllgll.llglalkeaalralllllllgletl
00420701   1/1  llllslae...llalrrgigyvfqdpalfpgltvrenlalgllla.glskaeararalellellglddll
00425571   1/1  l........lrrrigyvfqdpalfpgltvrenlalgllll.glskaeaaaralellellglddlldrlvg
00440861   1/1  tLlnaLlgllkpdegvilvggk..gvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadl
00361211   1/1  ldglei......salslaerlragigyvfqdlalfpeltvlenlalg..............rarellerl
00490801   1/1  GpnGsGKSTLlkllagllkptsGeilidgkdi......tglspqelrrlgglvlqdvllffltll.....
00510251   1/1  lvGpnGsGKSTLlkllagllkptsGeilidgkdi......tglspqelrrlgglvlqdvllffltll...
00466971   1/1  kdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgle
00482201   1/1  gls.......lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllglet
00502741   1/1  .......laelrgigyvfqqlallpsltvlenlalgll.llglskaeaaaraaellellgledlldrlps
00458601   1/1  .kditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrall
00482261   1/1  .......laelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletll
00466931   1/1  ilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellalll
00404101   1/1  lael......rrgigyvfqdpalfpgltvrenlalgll......kaeararalellellgldelldrlvg
00475991   1/1  Geilldg.......kdildlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalr
00530591   1/1  kptsGeilldgkditdls.......lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakea
00436071   1/1  ...........lrrgigyvfqdpalfpgltvlenlalgllllgll...ealaralellellglgdl.drl
00495371   1/1  vlvdgldltglspa......rggiglvfqteallppltvrenlealgldlrglld...rerviellelvg
00485451   1/1  kvlvigldi......frlsarelrkrig.vfqdpallphltvpenldlglll.......eilervlelle
00498251   1/1  tLalrllagllkpgggvvyidgeesldll.........rarrlgvvlqelllfpeltveenl........
00424961   1/1  pdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyf.rdegadvlllad
00469451   1/1  kdvlylsleesleqlrrrigyvfqdpalfp..........................aeellelvgledll
00500611   1/1  lggkvlyislee.....slrrrrigmvfqelgldpdltv..................arerviellelvg
00372301   1/1  ilvdgedlr................igyvfq...................................ller
00436511   1/1  ervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalp
00488521   1/1  i.....................ggkvlyvdqeeslfp.ltvlenlalg............gedveeller
00496111   1/1  ....lsaeelrerrrrigyvfqepalfpeltvlenlalgll...........................dr
00367481   1/1  sggilvpgedalll...................................................rvdei
00457311   1/1  yk.lsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk........llepvglpevld
00468691   1/1  ervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr........elrelrrrigyvfqdpalfpelt
00485931   1/1  ...........rrigavpqlpvlfprltvlenlalg........gadlaeraeellellglegfdvvliD
00475521   1/1  ......dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldr
00495031   1/1  kvlyigleltlsperlrlraqsl...........................gldldellerllvidllelv
00422141   1/1  deeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledl
00379601   1/1  lsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltle
00448931   1/1  .........areqlgivfqd....pgltvlenlalg..........eleararellellgledydvvliD
00532531   1/1  gfyakaigllrrkigyvfq...lfpfltvlenvalgld...glvdeedleraenllalvgleeipnryps
00478411   1/1  kd..........gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypd
00381441   1/1  evdgvdltfls..........reeigyvfqepallpdltvlenlylglllalllaleegkivildgdrer
00503371   1/1  geirldgkdlliylsdlir.........rgagiayveqefdlfdgltvlenvllglgdeliirrrilrdg
00437981   1/1  kdi..............rrgiglvfqliglfphltvlelvalgl...ggilveevrellkel........
00468601   1/1  .....aaae.rlgigavpqdvplfpsltvldnlalar.dlleaa..kaagydvvlidtaglld.ldrlvg
00414121   1/1  gqll......edlgvlavrlgigyvpqtlglfpaltvlellalall........................
00464791   1/1  ervglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerpre..............vrellglllelg
00371631   1/1  klalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtD....ifylpa.eqlkri
00477971   1/1  ttrpprpgevdg.vgyvfqsrelfpeltvagnfle.gaevrgnlygtsrerveellea.gldvlldidpq
00515511   1/1  vklqlwDtgGqerfrslwllyfegadaiifvvdlsdgds...llalrrwigrlfqslnllesllvlenla
00515531   1/1  ..vklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlan
00462761   1/1  ...........lglliglvfqdpdllpfltvlenvllpllaagliv......ivdgtlllvglrealrkl
00368501   1/1  GvGKTtlaralakll..gapfiridgs..eltek.dyvGesvearlrelfeeaigyvfqdpalfpg.tvl
00475371   1/1  ...........................................rrpsarellgllgellgldvlvgargg
00478441   1/1  .......elrgrdilmvfqppalfpllevrglniaevlela.glskaealkrvdlvlelvgld...dryp
00475381   1/1  rdllgllreglirigyvfqdyalfprltvlenvllgll.........................llgglvv
00356411   1/1  ltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenv...
00480471   1/1  ldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllg.ldllllellkelkydpv
00426051   1/1  dlggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviell
00533501   1/1  ..tp.......lgrgigyvfqdpalfpglt.vrenlelllvfadrygvlrglikpalaegvsvildrvgl
00464411   1/1  eplge.......ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla..ypg
00496571   1/1  epirgeplgelir..glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfp
00379961   1/1  dlldpkdlrellragiplvflnfaalpasllesel...................................
00487021   1/1  a...............gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..lld
00512891   1/1  .......rsarrgigyvfq.........tveellgllaelvgle............vrgeleellktlik
00493431   1/1  gevr........gigyvfqsgalfphlivagnlleg.aevhgllygtskerveeale....kgllvlldr
00508671   1/1  ldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl.elrdelrellkeaglpll
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpel---------
00510561   1/1  prGelvliaGppGsGKTtlalqlaanlaaqggkvlyis..teesleql......rarrlgldldrlllld
00368571   1/1  pvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyagla..rglgvvildpgdgr
00468951   1/1  GglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid.........teesldqlrarrlgldlddl
00437941   1/1  .gvrvlgidaselld.......................................................
00379261   1/1  GKTtlaralAkll..........gapfvevdaselteggyvgedlekrirelfqearllvfltvlenirl
00434401   1/1  ...paaelllreglgidfqlpdal.....................drellre.evlellglgevvivdvy
00490731   1/1  ...........................................yrpaadellgvlaeelgldvllgargg
00503741   1/1  lagllkpkfgeillfg..........................................kvvyvnvselld
00498531   1/1  prGsltliaGppGsGKTtlalqlaanlaklggkvlyis..teesleql......rarrlgldldellllp
00484101   1/1  ..grldldellg.igylfqdvgllpvltvrenlalllrglpgysaeele.ralellelagfdvilieGll
00477011   1/1  lsetpgltvlvvflelgerldllglvfqdfsllpelielenrala............gpiagisrdairl
00532471   1/1  lggaalldivdegrliglvfqdldllpllevlellaa........................rleelleri
00451571   1/1  .........lreaiglvtqdgelllelid.egilvpdeiv........iellrealeeldadgvildgfp
00498811   1/1  ....relvaggglliglifqdfglfelldrellielllenlalglal.egvildalrrrllelldllgld
00405881   1/1  elddgrqlvlvDtpGliel..aslgeglvrqalealeradvillvvdasd....................
00480441   1/1  epregevlg....vdyvfvdrelfeelivagnlled.aivhgllygtskerieealda.glgvlldgfpr
00499191   1/1  ..........gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldr
00489571   1/1  ......................................................................
00470731   1/1  ralakel..gagfilidg........ddlrekavgeleklgrdlfqvaregglvpdilfideidall.rk
00392701   1/1  ...............................................................llgkyvg
00406781   1/1  ...............................................................llgkyvg
00404191   1/1  anelkkrggrvlyvsa......................................................
00511381   1/1  .....lgielvvsriglvleavglffaldllelll...................................
00439861   1/1  ..esreqlleraerlgldleellllgll...................................siliadp
00489631   1/1  ddllrellgellgrgigfgfqqgdlledatvlenlalllldeidka.....................led
00513761   1/1  lpeqlgidirdlid.................letvme.lglgpngalvfaleellttldillealell..
00513251   1/1  ......................................................................
00499331   1/1  repvig......agtdigevfqdlllaggllvddev..................rrlllealdelllagg
00432181   1/1  veldgrkl..............................................................
00444381   1/1  lellgarpgenvlLvGppGtGKTtlakalakll..gvpfirid...........................
00527261   1/1  kpviyidlselsskgyv.dleellrelaeelgell.......................ellkkllkklse
00480251   1/1  rpsapeqlgilgellg..................vpvvgvltgldlagalrealell.......llegyd
00402371   1/1  aselle..........................................................fgkyvg
00420941   1/1  ....................................................sellg.........kyvg
00515351   1/1  .............pggtdigelfqdyllfpfltvdeni...............rglllealeellaag.k
00367291   1/1  apfirvda...........................................................sel
00394721   1/1  ........................................................vrldlsellsvsdl
00386741   1/1  ..............................................................pfvrldas
00378841   1/1  eidgkkvklqlwDtaGqerfrsllelyy...rgadgillvvdvtdresfeelkkwleeilrlle.agvpi
00517691   1/1  ...............................................gtlllllgllsfllalvldslpl
00437921   1/1  lgsgggvdvielda........sdlrgvddlreligevlqalglllgg......................
00533151   1/1  gldig.......................evfqda.leaglllfddefrglller................
00482551   1/1  klggkvlyisteeafsperlreralslgldleelldrllvidat..........................
00437901   1/1  GppGvGKTtlakalakel..gapvieidaselrd....................................
00457851   1/1  vistddllreavpggtrlgeviqdlfllggllffdeldel...........lkerieellaag..gvild
00461621   1/1  ...revvergtelgklikdyfdpgalvpd..llirlllerllfldegggflldgfprtleqaeals....
00496061   1/1  .........evepggtdlgeifqalllagel.lfddevlgll..........rerldelielllaggvvi
00472911   1/1  ggkpl...............................................................gl
00521551   1/1  ..............................................................elvgkyvg
00416171   1/1  ..........................................................dlleselfghek
00478391   1/1  gddllrelvgeggrlgrdlfdedrllfrellideidl.................................
00482721   1/1  ddlyrelvaggtplgerirellgegyllpdealfrallaellfgdllala............lldgvvyd
00489391   1/1  avpggtdlgel.......fqdlllegellfideiaelllealae..........................
00487061   1/1  gargldvvviyepvdywaavgggdllrlirelllrlgfgepdafdnellgellealleg...........
00476071   1/1  .....ggpllerirellgegyllfdealdrellaallfglelegal........................
00430121   1/1  ltekllvselig.......................................................hpp
00410531   1/1  .........................................gefv.dygptigvnfktvevdg.vklviw
00516041   1/1  ......lrgeelgriielfdearelvpelallfideidell...........................ak
00469161   1/1  gfgtplgelirelllegfqdlilvpdllvlellaan........raglrelikellaa.gkgvildrfpl
00410321   1/1  ----------------------------------------------------------------------
00473941   1/1  ...............................................................pfielsa
00495771   1/1  ----------------------------------------------------------------------
00478081   1/1  ..............................................ddlrreairelllgldlleilfeg
00457881   1/1  vidtddllrelepdgtelgellqdlllaggllpdaivrdlllel...........leelladgkgv.ild
00401211   1/1  ................................................................ldtlkg
00493171   1/1  .........epregevdgvdyvfvsgelfkelidagelled.aivigllyergtlldavegalld.....
00477561   1/1  ................................................alifqdeldlfdedreegfrvp
00441251   1/1  lidkkvvlldEadstcwdyivellkn--------------------------------------------
00418301   1/1  .................................................................pfirv
00483811   1/1  llgqpk................................................................
00409841   1/1  ......................................................................
00477721   1/1  lvgegielilelfdrarfrkllielldellaaggvvldlgrtlllrralrellreldlvvfld.....ap
00519581   1/1  ...........fgdvgglvvdli...............................................
00403151   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00509891   1/1  ld....................................ldeplgv..drerlrrvgelalllaggglcal
00470231   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAETNITQVIVTHEVEVARKTASR
00390411   1/1  glvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglk
00422801   1/1  kaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraelle
00378981   1/1  lvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealr
00367901   1/1  palfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieera
00379581   1/1  llelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltv
00509431   1/1  rligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeele
00500441   1/1  ldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlse
00475891   1/1  ldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldea
00420701   1/1  drlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsea
00425571   1/1  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealalad
00440861   1/1  vllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpn
00361211   1/1  glail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelg
00490801   1/1  ......lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDp
00510251   1/1  ........lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgL
00466971   1/1  tlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdld
00482201   1/1  lldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlse
00502741   1/1  eLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladr
00458601   1/1  lllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltv
00482261   1/1  drlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal
00466931   1/1  dlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpv
00404101   1/1  eLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdlde
00475991   1/1  alllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakeg
00530591   1/1  alralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrela
00436071   1/1  vseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalal
00495371   1/1  leelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvt
00485451   1/1  lvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrt
00498251   1/1  ........................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarell
00424961   1/1  sllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDep
00469451   1/1  drlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH
00500611   1/1  llelldrlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvll
00372301   1/1  vgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfv
00436511   1/1  allrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsrlder
00488521   1/1  lgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlL
00496111   1/1  lpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvth
00367481   1/1  ltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgat
00457311   1/1  ryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdl
00468691   1/1  vlenlalgallag.................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEp
00485931   1/1  tagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvth
00475521   1/1  lp...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeilell-----------
00495031   1/1  gllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilv
00422141   1/1  glsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.............
00379601   1/1  dllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel...
00448931   1/1  tagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvth
00532531   1/1  elsgGqqqrv...........illldEPtsgLdpvsr...........................leladr
00478411   1/1  elsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.................ldi
00381441   1/1  aeellellgldadlviilpasleellerldrrggelsggqkqRvala-----------------------
00503371   1/1  rseyllnglgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeel
00437981   1/1  ........lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlse
00468601   1/1  elsggqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgtakgghdl
00414121   1/1  ...lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltv
00464791   1/1  vlf....................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvlll
00371631   1/1  gllfq.kglpealdveell....................ellldl.kegledilvpvlsggqkqrlalar
00477971   1/1  glsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealelld
00515511   1/1  nvpillvl.nKiDlleaklvllllvglfdlldglpselsggqkqrvalara-------------------
00515531   1/1  vpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalarala----------------
00462761   1/1  lgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.
00368501   1/1  enlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallg
00475371   1/1  dlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlk
00478441   1/1  yelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvdrl---------
00475381   1/1  ildggvrqrlalarallldpdvllldeplllldaalr...........dlpdlvifldadpeelle----
00356411   1/1  piilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaralakdpdill-----------
00480471   1/1  illlnkidllddrllrraeaeerieellelvgl-------------------------------------
00426051   1/1  le.gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeelle
00533501   1/1  sdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrleh
00464411   1/1  flsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrlehylelaepykd
00496571   1/1  rtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeel
00379961   1/1  ...lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlll
00487021   1/1  rippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlviflda
00512891   1/1  elsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladr
00493431   1/1  dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddle
00508671   1/1  .vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi...dts---------------
00387201   1/1  ----------------------------------------------------------------------
00510561   1/1  altv................eellalaerll................sggkvdlvviDsltalapalels
00368571   1/1  svrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselgl
00468951   1/1  lllpaltveellala................................erllsggkpqlvviDsltalrpa
00437941   1/1  .......pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrl
00379261   1/1  daseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllggl
00434401   1/1  dlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlk
00490731   1/1  dlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaad
00503741   1/1  lkellrlllealglp.....ppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelL
00498531   1/1  altveellala................................erllsggkpdlvviDsltalapsllll
00484101   1/1  elalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllell-----------
00477011   1/1  eielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandld-----------
00532471   1/1  ppalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyl----
00451571   1/1  rllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallk-----------
00498811   1/1  vvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd
00405881   1/1  ....plldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee.......lggtvv
00480441   1/1  glsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddle
00499191   1/1  yprllsggqrqrvaia.....dpdvlildgptllldpe............................lrpl
00489571   1/1  .......lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.a
00470731   1/1  gpdvildgagrtpeqlealldllee.......lgrpvvviilttnrevlldral.rRpgrllldep..--
00392701   1/1  elsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtvia
00406781   1/1  elsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtvia
00404191   1/1  .................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellellde
00511381   1/1  ..................qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfe
00439861   1/1  lglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelil
00489631   1/1  ggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryrad
00513761   1/1  eedydyiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipii
00513251   1/1  ....gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldr
00499331   1/1  kvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeelt
00432181   1/1  ............vliDtpGleefasggekqrvalalallreadvlllvvdadeptsf-------------
00444381   1/1  ................................gselte.....kelvGesegailsggfkqrvgia..ll
00527261   1/1  llglsilglelilglsggdleelleelaellkklgkpvililDEiqslldvsskelleaLlrlldegknv
00480251   1/1  vvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaa
00402371   1/1  afegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nvrviaat----
00420941   1/1  elsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqa--------
00515351   1/1  vvildglsggllqrvallrallrpdlvifldap-------------------------------------
00367291   1/1  leklvg...........egegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlle
00394721   1/1  vgelegglrgllteala..lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlvi--------
00386741   1/1  elsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsgvl
00378841   1/1  ilvgnKiDllgrqvlveearalakelgiplf..etSaktgegvdelfealvk------------------
00517691   1/1  erergitidvalarllldgrkilllDtPGhedfvkevlralrladgallvvdadegv-------------
00437921   1/1  .......................................kpdvlllDEi.drldpdaqnall--------
00533151   1/1  ...leellargpvvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevl
00482551   1/1  ...dlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakelg
00437901   1/1  ............................vddlsgyvgelsggeklrellaealteavlkgkp--------
00457851   1/1  gfpldlegaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrelyerli
00461621   1/1  kpavlsggrkqrlalaralavdpe.lildg----------------------------------------
00496061   1/1  ldgfpldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevlekrlerylely
00472911   1/1  lfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifldadpevll
00521551   1/1  elegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnvlvia
00416171   1/1  gafgggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlpadvrliaatn
00478391   1/1  .................llakgkvvildgtnlsealdealrrllr.........pdlvifldaple----
00482721   1/1  rlrdellaelsggqgdvliiegalllepgllplpdlvifldappevl-----------------------
00489391   1/1  ..................aegkvvildgtg..ldieqrealrelllel.prpdlvifldadpeell----
00487061   1/1  ...............................gki.vlsarraqlleirlirpllaegkvvilDrepd---
00476071   1/1  .ldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvi-----------------------
00430121   1/1  gyvGedelgvlfeaarkappsvlllDEidkl.....dpdvlnaLlqlleegevtdlgg------------
00410531   1/1  DtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalll
00516041   1/1  gkvvildgtgrlleldealellgpdlviflda--------------------------------------
00469161   1/1  srlayqlsggerqrlaidlegalllerll-----------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00473941   1/1  sdllgesdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggg--------
00495771   1/1  ----------------------------------------------------------------------
00478081   1/1  lllsdefrelleealalladgdvvilDgfgrllda-----------------------------------
00457881   1/1  gfprdleqaealrallaelglppdlvifldaplevlleRllkrgddp-----------------------
00401211   1/1  elergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhedfl-------------
00493171   1/1  ...gfpv.lldgalqlllllrelllkpdlvilldvslevlleRllkRgrdseevikkrleryleet.pli
00477561   1/1  eelvrellkel.larllaeggdvvilDgt..nltleqrealrrllkel.grpdlviyldapdeelle---
00441251   1/1  ----------------------------------------------------------------------
00418301   1/1  daselteaelvGyesgarlrelfaragigllaladpgvlflDEidkllpargssggdv------------
00483811   1/1  ........lydlleellellldegekipveliiellkdvlvsdpdviilDelpgtnlklqdletls----
00409841   1/1  ..............vlldgrdllllDtPGlidfaseptnlldleiieallraleead-------------
00477721   1/1  leelleRllkRggrfdllielplleelkeilrellplykeladlv-------------------------
00519581   1/1  .dleaverhlldiaeellengeilildeptvgldsk...dildelakilkevnfelifithdedelr---
00403151   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00509891   1/1  vaddlagaleel.laralaggpdviliEgagllplp----------------------------------
00470231   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VIYMENGHIVEHGDAGCFAHPQTEAFKNYLSH--------------------------------------
00390411   1/1  eeaekakalleel---------------------------------------------------------
00422801   1/1  llrelak.gltvllv-------------------------------------------------------
00378981   1/1  ladrilvlddGrivelgtpeellenpaslyt---------------------------------------
00367901   1/1  eellellglgglldrp------------------------------------------------------
00379581   1/1  llvthdldealrla--------------------------------------------------------
00509431   1/1  ligplldglellvglnglldrplselSgGek---------------------------------------
00500441   1/1  alrladrilvlddGrivelgtpeellenpksly-------------------------------------
00475891   1/1  lrladrilvlddGri-------------------------------------------------------
00420701   1/1  lrladrilvlddGrivelgtpeellenpasly--------------------------------------
00425571   1/1  rilvlddGrivelgtpeellenpaslytaell--------------------------------------
00440861   1/1  lfpglvvlisaltgegldeltvrenlal------------------------------------------
00361211   1/1  vtvilvthdldlldsallrpgkrpllsdlrgs--------------------------------------
00490801   1/1  etraellellrela--------------------------------------------------------
00510251   1/1  Dpetraellellrel-------------------------------------------------------
00466971   1/1  ealrladrilvlddGr------------------------------------------------------
00482201   1/1  a.rladrilvlddG--------------------------------------------------------
00502741   1/1  ilvlddGrivelgt--------------------------------------------------------
00458601   1/1  llvtHdldealrla--------------------------------------------------------
00482261   1/1  .ladrilvlddGri--------------------------------------------------------
00466931   1/1  stLSGGerqrvala--------------------------------------------------------
00404101   1/1  alrladrilvlddGrivelgtpeellenpl----------------------------------------
00475991   1/1  ltvllvtHdlseal--------------------------------------------------------
00530591   1/1  k.gltvllvtHdls--------------------------------------------------------
00436071   1/1  adriv-----------------------------------------------------------------
00495371   1/1  hdleeveeladrv---------------------------------------------------------
00485451   1/1  iilvthdlreae..--------------------------------------------------------
00498251   1/1  ellrrllrlakel---------------------------------------------------------
00424961   1/1  tsalDgeivlslllalkr----------------------------------------------------
00469451   1/1  ........Asdrvlv-------------------------------------------------------
00500611   1/1  vthdlreveelad---------------------------------------------------------
00372301   1/1  tHdlelaalladrvvvlndgriv-----------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00488521   1/1  krlakelgvtvllv--------------------------------------------------------
00496111   1/1  dleeaedladsgri--------------------------------------------------------
00367481   1/1  vlvvtHdlelaalaadriv---------------------------------------------------
00457311   1/1  geagrsadrvl....gri----------------------------------------------------
00468691   1/1  tsgldalr..eilellrellkel-----------------------------------------------
00485931   1/1  ddgtakggaalsla--------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00495031   1/1  thdlrevegrlel---------------------------------------------------------
00422141   1/1  .....ieyvfqspnlfpl----------------------------------------------------
00379601   1/1  .........lrnki--------------------------------------------------------
00448931   1/1  lDllakggadlsl---------------------------------------------------------
00532531   1/1  iyvllsGrivesgtt-------------------------------------------------------
00478411   1/1  ilalelllldel----------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00503371   1/1  lklleeleellk----------------------------------------------------------
00437981   1/1  llpallsrcqvirfpplsee--------------------------------------------------
00468601   1/1  slalrladrilvl---------------------------------------------------------
00414121   1/1  livlnKiDllsel---------------------------------------------------------
00464791   1/1  lDEptsgldal..---------------------------------------------------------
00371631   1/1  alvedpdvlilDgpta------------------------------------------------------
00477971   1/1  rilvl...l-------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00462761   1/1  ieevadrilall----------------------------------------------------------
00368501   1/1  ggrelrdgellkalk-------------------------------------------------------
00475371   1/1  aadrilvldlg-----------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00426051   1/1  llerlarey-------------------------------------------------------------
00533501   1/1  ylellekad.r-----------------------------------------------------------
00464411   1/1  dvvvidangsi-----------------------------------------------------------
00496571   1/1  adrlialyegav----------------------------------------------------------
00379961   1/1  pagvtviaatnddl--------------------------------------------------------
00487021   1/1  dpeell...eR-----------------------------------------------------------
00512891   1/1  iallrrgrivelgp--------------------------------------------------------
00493431   1/1  ealeelldii------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00510561   1/1  llldeptsgldas---------------------------------------------------------
00368571   1/1  rdladrle..klvaggl-----------------------------------------------------
00468951   1/1  lllldeptgell----------------------------------------------------------
00437941   1/1  eeldpallsRfdviefpppdeeel----------------------------------------------
00379261   1/1  glpevgelllelldd-------------------------------------------------------
00434401   1/1  rlgrs-----------------------------------------------------------------
00490731   1/1  rilvlleglg------------------------------------------------------------
00503741   1/1  lrlleegkltd-----------------------------------------------------------
00498531   1/1  depgrvtqgldar---------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00498811   1/1  .lsleevvdrila---------------------------------------------------------
00405881   1/1  lvSahdgegldelldaile---------------------------------------------------
00480441   1/1  ealelllaillal---------------------------------------------------------
00499191   1/1  adlv------------------------------------------------------------------
00489571   1/1  Drvavldd......Gtpeellarpanpyvr----------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00392701   1/1  ttnrpeeld-------------------------------------------------------------
00406781   1/1  ttndlee---------------------------------------------------------------
00404191   1/1  laergv----------------------------------------------------------------
00511381   1/1  gsllL-----------------------------------------------------------------
00439861   1/1  dalagggaleqla---------------------------------------------------------
00489631   1/1  lvivtd----------------------------------------------------------------
00513761   1/1  lvlnKlDll-------------------------------------------------------------
00513251   1/1  vllldegslvdlgv--------------------------------------------------------
00499331   1/1  rdliely---------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00444381   1/1  adpgilflDEidkll-------------------------------------------------------
00527261   1/1  tiilt-----------------------------------------------------------------
00480251   1/1  lgaalsvalilgl---------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00367291   1/1  el--------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00386741   1/1  vi--------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00533151   1/1  ekrleryl--------------------------------------------------------------
00482551   1/1  vtviltsqltrev---------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00457851   1/1  epyee-----------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00496061   1/1  erl-------------------------------------------------------------------
00472911   1/1  eRllkrgrallree--------------------------------------------------------
00521551   1/1  at--------------------------------------------------------------------
00416171   1/1  pdllelvlegelrpa-------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00410531   1/1  revsae----------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00493171   1/1  dyydl-----------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------