[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67786.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
  40::150  3.5e-07 19.8% 0053395 00533951 1/1   myosin                                  
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
00533951   1/1  ---------------------------------------mdaikkklqalklekenaldraeeaeaklke


                         -         -         *         -         -         -         -:140
query           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
00533951   1/1  aesrlekleeelaalkkklglleeeldeaeerleeaerkleeaekrlekaeselaslerriqlleeeler


                         +         -         -         -         -         *         -:210
query           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
00533951   1/1  aeerldtaeq------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALITERRRTKALEDALRAHGLID-----------------------------------------------
00533951   1/1  ----------------------------------------------------------------------