[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF67908.1


[Show Plain Result]

## Summary of Sequence Search
   1::406
 211::406  1.6e-46 35.2% 0051509 00515091 1/1   -like ATPase domain                     
 211::406  7.5e-44 32.7% 0051456 00514561 1/1   -like ATPase domain                     
  86::399  1.5e-43 28.9% 0049498 00494981 1/1   -like ATPase domain                     
 208::390  2.5e-37 30.8% 0051804 00518041 1/1   -like ATPase domain                     
 212::398  4.6e-34 28.9% 0052961 00529611 1/1   -like ATPase domain                     
 211::396  2.1e-33 30.0% 0051732 00517321 1/1   -like ATPase domain                     
 211::401  1.7e-30 30.9% 0050912 00509121 1/1   -like ATPase domain                     
 212::401  1.6e-29 30.4% 0053028 00530281 1/1   -like ATPase domain                     
  82::210  3.3e-28 31.8% 0051508 00515081 1/1   -like ATPase domain                     
  82::210  2.2e-27 34.4% 0051457 00514571 1/1   -like ATPase domain                     
  83::209  3.9e-25 31.7% 0053029 00530291 1/1   -like ATPase domain                     
  84::211  1.5e-24 31.0% 0050670 00506701 1/1   -like ATPase domain                     
  86::207  3.2e-22 33.3% 0051805 00518051 1/1   -like ATPase domain                     
  86::210  1.3e-21 33.3% 0050911 00509111 1/1   -like ATPase domain                     
  85::209  1.7e-21 32.5% 0052960 00529601 1/1   -like ATPase domain                     
  85::210  1.4e-20 30.2% 0051731 00517311 1/1   -like ATPase domain                     
 211::391  6.2e-18 30.8% 0050671 00506711 1/1   -like ATPase domain                     
  11::81     1e-16 43.7% 0051455 00514551 1/1   ed helix" DNA-binding domain            
 210::390  6.8e-16 19.2% 0049353 00493531 1/1   -like ATPase domain                     
  12::81   7.8e-16 45.7% 0051507 00515071 1/1   ed helix" DNA-binding domain            
  85::389  8.5e-15 20.3% 0047243 00472431 1/1   -like ATPase domain                     
 213::405  9.5e-15 27.9% 0052165 00521651 1/1   -like ATPase domain                     
  83::205  4.5e-05 23.9% 0052166 00521661 1/1   -like ATPase domain                     
 171::360  0.00011 18.7% 0038007 00380071 1/1   -like ATPase domain                     
   1::406


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVADSQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGS
00515091   1/1  ----------------------------------------------------------------------
00514561   1/1  ----------------------------------------------------------------------
00494981   1/1  ----------------------------------------------------------------------
00518041   1/1  ----------------------------------------------------------------------
00529611   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00506711   1/1  ----------------------------------------------------------------------
00514551   1/1  ----------dlvrelnrslvlrllrrngpisraelakltgLspatvtkivseLleeglvlelgllesgg
00493531   1/1  ----------------------------------------------------------------------
00515071   1/1  -----------llldlnqllvlrllrengplsraeLarllglspatvtrivdeLeeaglveevgdpedgr
00472431   1/1  ----------------------------------------------------------------------
00521651   1/1  ----------------------------------------------------------------------
00521661   1/1  ----------------------------------------------------------------------
00380071   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVEECLPLPLTEATPLLERIITHVDRFFTRHQ
00515091   1/1  ----------------------------------------------------------------------
00514561   1/1  ----------------------------------------------------------------------
00494981   1/1  ---------------gyvlgiDiGgtnirvalvdldgevlarvriptpnp.....fdeildaiaelleea
00518041   1/1  ----------------------------------------------------------------------
00529611   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00515081   1/1  -----------pdaayvlgidiggtkiklalvdldgevlarlriptpapdpeavldaiaelieellaelg
00514571   1/1  -----------pdaayvlgidiggtkiklalvdldgeilarlriptpaldpeavleaiaelieellaelg
00530291   1/1  ------------Pdaayvlgidiggtkikvalvdldgevlarvriptpadldpealldaiaelieellae
00506701   1/1  -------------mkyvlGidiGgtkikaalvdldgevlarariptpglaeqdpeavldaiaelirella
00518051   1/1  ---------------yvlgidiggtkiklalvdldgeilarlriptpasdpeavldalaelidellaeag
00509111   1/1  ---------------yvlgidiggtkikaalvdldgeilarlriptp..gpeavleaiaelikel.....
00529601   1/1  --------------myvlgidiggtkikvalvdldgeilarvriptp.adpealldaiaelidel.....
00517311   1/1  --------------alvlgidiggtkiklalvdldgeilarlriptpadldpeavldaiaelidellael
00506711   1/1  ----------------------------------------------------------------------
00514551   1/1  ggrpilllleg-----------------------------------------------------------
00493531   1/1  ----------------------------------------------------------------------
00515071   1/1  rgRpavllsln-----------------------------------------------------------
00472431   1/1  --------------smlilGIDlGttntkaalvdedgeilaeasvp.....pedalealleaikealeea
00521651   1/1  ----------------------------------------------------------------------
00521661   1/1  ------------mmklylGiDgGgTktkavlvdedgkilarakagttnplllgleealeaiaeaveeale
00380071   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
00515091   1/1  ----------------------------------------------------------------------
00514561   1/1  ----------------------------------------------------------------------
00494981   1/1  gld...ilgigigvpgpvdddtgiltnlp.....wgfdlkd.leealglpvvaleNDanaaalallllde
00518041   1/1  -------------------------------------------------------------------Agk
00529611   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00515081   1/1  ldlsrllgiGiavpGpvdldtgvvlsapnlpgwrgvdlaelLeealglpvvvenDanaaalaEllfGagr
00514571   1/1  ldlsrllgiGiavpGpvdletgvvlnapnlp.wrgvdlaelLeealglpvlvenDanaaalaEalfGagr
00530291   1/1  lgldlsrllgiGiavpgpvdldtgvvlnapnlg.wrgvdlaelLeealglpvvvenDanaaalaEalfg-
00506701   1/1  eagls.grilgiGigvpglvdldtgvvllapnl.gwndvdlaelleellglpvlvenDanaaalaEalfG
00518051   1/1  ....rilgigigvpGpvdaetgvvllapnlg.wrgvplaelLeerlglpvllenDanaaalaEalfG---
00509111   1/1  ....dilgiGigvpGpvdletgvvlyglitaanllgwrgvplkelLeealglpvvvenDanaaAlaEllf
00529601   1/1  ....dilgiGigvpGpvdldtgvillapnlpgwngvplaelle.llglpvllenDanaaalaEllfGaG-
00517311   1/1  gl.......iGiavpGpv..adgvvlllnapnlpgwrgvdlaelLeealglpvfvenDanaaalaE.lfg
00506711   1/1  ----------------------------------------------------------------------
00514551   1/1  ----------------------------------------------------------------------
00493531   1/1  ---------------------------------------------------------------------l
00515071   1/1  ----------------------------------------------------------------------
00472431   1/1  gisfddidaiavtgqggglagldvvgl...........................vndplaaalaagllga
00521651   1/1  ----------------------------------------------------------------------
00521661   1/1  kagldlsldllavglglaGaid..........pllglilvpllkellellglpvlvenDanaall-----
00380071   1/1  ------------------------------elaylyaiPaelydevgvrrygfHglshkyvarraaellg


                         -         -         -         +         -         -         -:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQL
00515091   1/1  gldnflyltlgtGiGgGivlngkllrlGanglAEiGhlpvdpdgplcgcgnrgclEtyaSgpallrlyre
00514561   1/1  gldnfvyltlgtGiGgGivingkllrGanglagEiGhllvdpdgllcgcgrrgclEtyasgpallrlare
00494981   1/1  dlealfgagkglddgvvlilglGtGigvaglvlngkllrging...eaGhighlpggdfdlalldclcgn
00518041   1/1  gvdnllyltlgtGiGgGivlngkllrganglagEiGhlpvpllralelaldpdgplcgcgnrgclEtyaS
00529611   1/1  -ldnfvyltlgtGiGggivlngkllrganglagEiGhllvdp.....rcgnrgcletlaSgpallrlyra
00517321   1/1  gldnvvyltlgtGiGggivlngkllrganglagEiGhlllppdgllcycgrrgcletlasgpallrlyre
00509121   1/1  gldnvvyltlgtGiGgGivingkllrGa..lagEiGhllvplldpdgplclcgnrgvcletlasgpal..
00530281   1/1  -sdnlvyltlgtgiGgGivlngkllrGanglageiGhllvdpdgplc......cletlasgpallrra..
00515081   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00506701   1/1  a---------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00506711   1/1  glgnvlyltlGtGiGggiildgkllrg.....gElGhl..........cgnrgclealasgpalvr....
00514551   1/1  ----------------------------------------------------------------------
00493531   1/1  edlnlivvhLGtGvsggailnGksvdtsmglpleglvmgtrsgdldpgcglylcletgasatelvrl...
00515071   1/1  ----------------------------------------------------------------------
00472431   1/1  geg....lvldiGggttdvsivkdgklvvgalggdgelgggllddaiarllglgfpgaiellasglalvr
00521651   1/1  --edgivvilGTGsgaggi.....................dpdgrlcrcGgwGhllgdegSgywigrral
00521661   1/1  ----------------------------------------------------------------------
00380071   1/1  kgleelnlivahLGnGasvaaiknGksvdtsmGltpleGlvmgtRsGdldpgvllylllelgl.......


                         -         *         -         -         -         -         +:350
query           RLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADI
00515091   1/1  llglgllslldlegldaeeifeaaragdplaleildefaralaralanlinlldpeaivlgGglsraldl
00514561   1/1  llglglesllsglealdaeeifeaaragdplaleildeaadalaralanlinlldpeaivlgGglsrlgd
00494981   1/1  pgclsleklasgpgllrllrllleklglegsll...daeevfeaaragfdplalaildraarllaralan
00518041   1/1  gpallrlaral.........ggelldaeeifeaaeagdplalealdefarylaralanlillldpelivl
00529611   1/1  llgleg........ldaeelfeaalagdplalealdrfarylaralanlvllldpeaivlgGgvsa.gdl
00517321   1/1  llg.dld.........aeeifeaaragdplalevldefaralaralanlillldpeaivlgGglsrlgd.
00509121   1/1  .....................eeifeaaragdplalevldeaarylaralanlinlldpelivlgGgvsn
00530281   1/1  ............egldaeelfeaaragdplalevldeaarylaralanlinlldpelivlgGgvsrlgdl
00515081   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00506711   1/1  ..............................alavldefarylaralanlillldpelivlgGgvsaagdl
00514551   1/1  ----------------------------------------------------------------------
00493531   1/1  lnkksgllglsg.ssdarevleaaeegdelAklaldafayrlakyigslaavldgepdaivltGGigens
00515071   1/1  ----------------------------------------------------------------------
00472431   1/1  l...........kgldlpfsglkitralfegleia.dilaallealaealadallrldepdrivlvGGva
00521651   1/1  ravlraldgrgpapalptaltealleylglsdlaellaflysappkaviAslaplvaeaaeegDplAlai
00521661   1/1  ----------------------------------------------------------------------
00380071   1/1  .sleellellnkesGllglsglssdlrelleaaeegdelaklaldlfvyriakyigalaavlggvdaivf


                         -         -         -         -         *         -         -:420
query           LFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG--------------
00515091   1/1  llealrealaklllpglledppivlatlgddagllGaalaldallegllllllleg--------------
00514561   1/1  llleairealaklllsgllelppivlatlgddagllGaalalqallelslllllle--------------
00494981   1/1  lalnlldpdgvvlgGgvaralpdlllspllrealeekllfsallgveiv---------------------
00518041   1/1  gGgvsaa.dlllealrealaelllp.alllpeivlaelgd------------------------------
00529611   1/1  llealrealaellrllplllelpeivlatlgddagllGaaalaldald----------------------
00517321   1/1  llealrealaklllps...dppivlatlgddagllGAaal..alde------------------------
00509121   1/1  a.ellldllrealrellldylrlplllellptlivlaklgddagllGAaal-------------------
00530281   1/1  llealrealarlllp..lllppivlatlgddagllGAaalaldallellll-------------------
00515081   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00506711   1/1  llellre............dlkivlaklgndagllGAaala-----------------------------
00514551   1/1  ----------------------------------------------------------------------
00493531   1/1  ellreailerleflgivldlegnlellalalailgndsgv------------------------------
00515071   1/1  ----------------------------------------------------------------------
00472431   1/1  r.npglrellaell..........glpvvvpenpdeava-------------------------------
00521651   1/1  lreaarelarllaavinlldpelllgaeslpvvlgGgvaragdllldalrealae---------------
00521661   1/1  ----------------------------------------------------------------------
00380071   1/1  tGGigensal------------------------------------------------------------