[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68005.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
  14::166  7.7e-50 39.2% 0052770 00527701 1/1   edoxin-like                             
  84::165  5.6e-21 35.4% 0037363 00373631 1/1   edoxin-like                             
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
00527701   1/1  -------------lseelleeieeilakypegrkrsaliplLhlvQeefgylpeealeavAellglplae
00373631   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
00527701   1/1  vygvatfYsmfslvpvgkhhilvCtgtaCalagaeellealkellgielgettldglvtleevgClgaCd
00373631   1/1  -------------vgkhhilvCtggrrdgrcgtaCllrgaeellealkkelgi...egladglvtlvevg


                         +         -         -         -         -         *         -:210
query           PNMMIDEDTHSHLTPEAIPELLERYK--------------------------------------------
00527701   1/1  laPvvvvndgvwygrltpekveeile--------------------------------------------
00373631   1/1  ClgaCalgPvvvvypdgvwYgrvtp---------------------------------------------