[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68113.1


[Show Plain Result]

## Summary of Sequence Search
   1::385
   2::384 8.5e-108 39.4% 0046007 00460071 1/1   ependent transferases                   
   1::385 2.6e-105 38.1% 0046747 00467471 1/1   ependent transferases                   
   2::383  1.3e-92 35.4% 0052070 00520701 1/1   ependent transferases                   
  22::386  1.7e-86 33.8% 0035846 00358461 1/1   ependent transferases                   
  31::385  2.7e-77 31.7% 0040134 00401341 1/1   ependent transferases                   
  28::385  2.1e-75 30.0% 0036406 00364061 1/1   ependent transferases                   
   4::385  6.6e-66 29.0% 0045973 00459731 1/1   ependent transferases                   
   8::383  1.2e-61 25.1% 0046154 00461541 1/1   ependent transferases                   
  23::385  1.4e-60 29.8% 0051601 00516011 1/1   ependent transferases                   
  23::385  2.1e-56 30.7% 0052157 00521571 1/1   ependent transferases                   
   4::385  1.7e-55 28.9% 0050157 00501571 1/1   ependent transferases                   
   1::385  2.4e-55 28.8% 0042809 00428091 1/1   ependent transferases                   
  36::387  3.6e-54 30.7% 0048571 00485711 1/1   ependent transferases                   
  32::385  7.1e-54 30.8% 0046584 00465841 1/1   ependent transferases                   
  14::383  3.2e-53 25.7% 0049754 00497541 1/1   ependent transferases                   
  34::380  6.6e-53 28.6% 0038034 00380341 1/1   ependent transferases                   
  20::387  4.4e-52 30.3% 0052943 00529431 1/1   ependent transferases                   
   2::386  1.8e-50 22.0% 0050261 00502611 1/1   ependent transferases                   
  43::385  1.1e-49 30.3% 0051757 00517571 1/1   ependent transferases                   
  35::385    4e-48 26.7% 0047340 00473401 1/1   ependent transferases                   
  36::384  1.4e-46 26.5% 0046165 00461651 1/1   ependent transferases                   
  23::385  2.3e-45 27.6% 0044807 00448071 1/1   ependent transferases                   
  37::385  3.3e-45 26.1% 0051195 00511951 1/1   ependent transferases                   
   1::385  6.8e-45 26.5% 0045392 00453921 1/1   ependent transferases                   
  47::387  2.1e-43 26.4% 0048074 00480741 1/1   ependent transferases                   
  56::385  5.8e-43 25.2% 0041704 00417041 1/1   ependent transferases                   
  55::383  6.9e-42 26.6% 0048952 00489521 1/1   ependent transferases                   
  37::384  1.6e-41 24.2% 0053335 00533351 1/1   ependent transferases                   
  30::385  4.7e-41 24.7% 0041260 00412601 1/1   ependent transferases                   
  33::385  4.7e-40 24.5% 0046056 00460561 1/1   ependent transferases                   
  41::380  1.3e-39 25.6% 0049486 00494861 1/1   ependent transferases                   
  32::385  1.5e-39 25.4% 0036780 00367801 1/1   ependent transferases                   
  54::385  1.6e-39 25.0% 0050754 00507541 1/1   ependent transferases                   
  40::385  4.6e-39 28.1% 0040897 00408971 1/1   ependent transferases                   
  88::387  2.7e-38 26.7% 0048747 00487471 1/1   ependent transferases                   
  37::385  6.2e-38 25.6% 0042144 00421441 1/1   ependent transferases                   
  75::381  1.3e-37 22.9% 0052302 00523021 1/1   ependent transferases                   
   1::362  8.5e-37 20.9% 0037039 00370391 1/1   ependent transferases                   
   1::383  9.3e-35 19.8% 0050390 00503901 1/1   ependent transferases                   
  38::380  2.8e-34 26.5% 0050076 00500761 1/1   ependent transferases                   
   1::383  5.3e-34 21.5% 0035589 00355891 1/1   ependent transferases                   
  38::385  1.9e-33 22.4% 0037569 00375691 1/1   ependent transferases                   
  17::385    7e-33 25.3% 0044083 00440831 1/1   ependent transferases                   
  12::386  1.5e-31 19.4% 0041674 00416741 1/1   ependent transferases                   
  39::384  1.9e-31 23.5% 0051723 00517231 1/1   ependent transferases                   
  15::385  1.1e-30 18.0% 0046965 00469651 1/1   ependent transferases                   
  37::373  2.3e-30 22.3% 0042806 00428061 1/1   ependent transferases                   
  10::383  7.8e-30 19.5% 0039341 00393411 1/1   ependent transferases                   
  14::383  8.4e-30 22.1% 0046087 00460871 1/1   ependent transferases                   
  38::385  9.7e-30 25.7% 0046547 00465471 1/1   ependent transferases                   
  40::383  7.8e-29 24.2% 0050753 00507531 1/1   ependent transferases                   
   1::383  1.2e-28 18.1% 0050696 00506961 1/1   ependent transferases                   
  12::383  1.5e-27 24.1% 0049070 00490701 1/1   ependent transferases                   
  29::385  3.3e-27 24.1% 0047095 00470951 1/1   ependent transferases                   
  13::378  8.8e-27 20.6% 0045171 00451711 1/1   ependent transferases                   
  14::385  7.2e-26 19.0% 0051323 00513231 1/1   ependent transferases                   
  49::380  2.4e-25 24.1% 0049524 00495241 1/1   ependent transferases                   
  45::383    1e-24 26.5% 0047441 00474411 1/1   ependent transferases                   
  37::383  1.2e-22 16.9% 0044595 00445951 1/1   ependent transferases                   
  47::385  1.2e-21 24.6% 0052164 00521641 1/1   ependent transferases                   
  21::380  6.9e-21 23.0% 0043583 00435831 1/1   ependent transferases                   
   9::383  3.5e-20 19.8% 0046024 00460241 1/1   ependent transferases                   
   1::383  1.3e-19 19.0% 0038952 00389521 1/1   ependent transferases                   
   1::385  1.8e-19 18.4% 0050768 00507681 1/1   ependent transferases                   
  21::383  2.6e-19 24.2% 0035246 00352461 1/1   ependent transferases                   
  55::385  2.8e-19 24.9% 0047670 00476701 1/1   ependent transferases                   
  81::387  5.4e-19 22.8% 0045909 00459091 1/1   ependent transferases                   
  41::385  2.4e-18 26.0% 0047581 00475811 1/1   ependent transferases                   
  12::383  3.2e-18 17.4% 0052862 00528621 1/1   ependent transferases                   
  46::381  3.4e-18 18.4% 0046206 00462061 1/1   ependent transferases                   
   1::385  5.1e-18 18.2% 0035401 00354011 1/1   ependent transferases                   
  53::387  2.4e-16 22.8% 0052731 00527311 1/1   ependent transferases                   
  32::380  4.8e-15 20.8% 0044523 00445231 1/1   ependent transferases                   
  18::383  7.3e-15 19.5% 0047956 00479561 1/1   ependent transferases                   
  42::387  2.6e-14 22.2% 0035700 00357001 1/1   ependent transferases                   
  32::387  1.6e-13 19.2% 0050977 00509771 1/1   ependent transferases                   
  55::387  6.1e-13 24.7% 0042383 00423831 1/1   ependent transferases                   
   9::383  2.5e-09 17.0% 0046089 00460891 1/1   ependent transferases                   
  42::383  3.5e-09 14.5% 0046255 00462551 1/1   ependent transferases                   
   1::372  5.3e-09 18.6% 0045639 00456391 1/1   ependent transferases                   
  37::381  2.1e-07 18.4% 0045068 00450681 1/1   ependent transferases                   
  42::383  2.2e-06 24.2% 0051993 00519931 1/1   ependent transferases                   
  32::380  3.3e-06 23.1% 0040526 00405261 1/1   ependent transferases                   
  44::385    2e-05 21.8% 0035586 00355861 1/1   ependent transferases                   
  42::387  0.00023 20.0% 0050340 00503401 1/1   ependent transferases                   
  12::381  0.00037 17.7% 0045231 00452311 1/1   ependent transferases                   
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFG
00460071   1/1  -dlldlldelleelkpeglyrplpivkgegarlidvdgreyldlssndylgghthpevveaaaealdklg
00467471   1/1  lllllllllllldeelllllaeelyrlplvivrgegarlldvdgreyidlasnnylglghhpavleaaie
00520701   1/1  -llldsleelldelipeglrrpfplllglplvlvralgrlldvdgkeyldlasnnylglhtppavleavl
00358461   1/1  ---------------------pplfdalvklaeegpysfhvpghkggvlnfasnlylgfpdfpgpneale
00401341   1/1  ------------------------------miplgsetrklldlisndylglaeiyllyasetpvppevl
00364061   1/1  ---------------------------lnpalsetellrelldlasnnylglasvillgasttpvppavl
00459731   1/1  ---dkllsellelllaagllrldpeifsalrkelkr.gkdlinliasnnyl....ppavleallealtnk
00461541   1/1  -------lselllllleglyevdpeiaeliekelkrqgevllliasenylspavlealgsaltn...kya
00516011   1/1  ----------------------msskelipgdlnsllrpftglldplvivraegaylydvdGneylDfls
00521571   1/1  ----------------------PlvivraegayltdvdGneylDflsglgvlnlGha.hpevvealkeql
00501571   1/1  ---leellelleslllsllyrlplvivraegayltdvdgrryldlssglpvnplGhs.ppevlealaeal
00428091   1/1  mpkslelldraklllpggvnsyvrlplvieraegaylydvdgnrylDflsgigvlnlGhn.hpevveala
00485711   1/1  -----------------------------------lelslpllltelpglsselllelllslllslyapl
00465841   1/1  -------------------------------efpllkgliyLd...naalgll.ppavleamaealeela
00497541   1/1  -------------nmllserldrlppsailelleladgpdvidlgsgep.dlppppavlealaealdn..
00380341   1/1  ---------------------------------llalgtdvihlgsgepdylgpvappiylsstftfevl
00529431   1/1  -------------------lklpkskelleellellpggvwhpvrafrlygplplvivraegaylydvdG
00502611   1/1  -lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdlglgpppavlealaealael
00517571   1/1  ------------------------------------------elirketlrlrgginasenvlslnvlga
00473401   1/1  ----------------------------------ealgkdliyl.gsgapglgtppvvraaaeaaadlfa
00461651   1/1  -----------------------------------kldtllvhagrlldlgtggidliilstgeppfpvp
00448071   1/1  ----------------------plvllrairsllpd.gdgviyldsagp..gplppavlealaeall...
00511951   1/1  ------------------------------------llkrllkldtlairagfpllartggvivldlsag
00453921   1/1  ptprskellerakklllggytsl.plvivraegaylydvdgnrylDflsgigvlnlGhn.hpevvealke
00480741   1/1  ----------------------------------------------iyldnagptplppavlealleglg
00417041   1/1  -------------------------------------------------------Pevlealaevle...
00489521   1/1  ------------------------------------------------------mdlsklldrletlalh
00533351   1/1  ------------------------------------lfkrlgrlppspirgllalladldgkdvidlgvg
00412601   1/1  -----------------------------ealellalgtdvihlgsnenplgavappiyqtptfvldala
00460561   1/1  --------------------------------lelellRelfplldlnllldgliyldnaattplppavl
00494861   1/1  ----------------------------------------liyldsdattpp..ppavlealaealevgd
00367801   1/1  -------------------------------kdlsletlaihagsgpdvlnlvgppiyltnefvfelpea
00507541   1/1  -----------------------------------------------------ryippteeeiaemldai
00408971   1/1  ---------------------------------------iplplgepdf.....peevleaviealdsgg
00487471   1/1  ----------------------------------------------------------------------
00421441   1/1  ------------------------------------kgviyldsaattpv....ppevlealaealesll
00523021   1/1  ----------------------------------------------------------------------
00370391   1/1  lavlnirllilvsllllkpllevdpeiaeiiekeldrqregleliaseNylslavlealgsvl...tnkY
00503901   1/1  mllserldrlgps..videllelag............gpdvidlgigep.dlppppevlealaealds..
00500761   1/1  -------------------------------------gtehidflsdnptgp..hpavlealaeallg..
00355891   1/1  Ms........llssrllglkpslvleilelaalldadgkdvidlgagepd.lppppavlealaealdsg.
00375691   1/1  -------------------------------------gpdvinlgigdp.dfplppavlealalaelidl
00440831   1/1  ----------------lgslpepevgaqgepielia.geeyldalvgaglinlghghpdvvidLlsdtlt
00416741   1/1  -----------issrllnlppyvfdeilelaalldadgpdvidlgvgep.dlppppavlealaealesg.
00517231   1/1  --------------------------------------llllleslaevdpeildliekelkrqrevleL
00469651   1/1  --------------llskrlerlppspilellellaggpdvidlgvgep.dlppppavlealaealdsg.
00428061   1/1  ------------------------------------lfsrlkalppspilklleaakrlggpdvidLgvg
00393411   1/1  ---------mllssrlrnlkpyvigpilelaaelgadgpdvidlgvgep.dlppppavlealaealesg.
00460871   1/1  -------------lklllepfrikvvepidptiaeeiekelkraggnlfllasenvyidlvs.daltgsp
00465471   1/1  -------------------------------------dliyldnaap....tplppevleamaealekly
00507531   1/1  ---------------------------------------lryigptegeiaemldalgvesldelfadvp
00506961   1/1  pgsgtfvsdrlpdlppspirellela..........ggpdvidlgigep.dlgppplpaviealaealds
00490701   1/1  -----------lllelalaldelellealrklfpllkgliyLd.....nasttpvppavleamlealeel
00470951   1/1  ----------------------------llllllfpllllfpllkgliyLdnagptplppevleamleal
00451711   1/1  ------------lfsrlkalppdpilallalaae.dpgpdvidlgvgvyldlepdlppppavlealaeal
00513231   1/1  -------------klllskrldrlgpspirallllaagpdvidlgigep.dfppppavlealaealdegg
00495241   1/1  ------------------------------------------------lldlldirllfpalslfalgkd
00474411   1/1  --------------------------------------------iyldgpgptplppevlealarall..
00445951   1/1  ------------------------------------lelssrldglpaslirellelaggpdvidlgvge
00521641   1/1  ----------------------------------------------lrllfpirelfpllmdliyldnag
00435831   1/1  --------------------geldlpglvhpftralslygplplvivraeGaylydvdGnrylDflsgig
00460241   1/1  --------mmdlssrlerlppsvirkllelaar.daggpdvidlgigep.dfppppavlealaealdell
00389521   1/1  ms...sflstllsprlkslkpyvigellelaaelgaggpdvidlgigep.dlgtpplelllltlvlpavl
00507681   1/1  llldlslllsdrllglppsvirkllelaa..........gpdvidlgigep.dlppppleavrealaeal
00352461   1/1  --------------------rkfiaeplriksaegvyltdvdgreyldalsgynvlllghgdpeiDlltD
00476701   1/1  ------------------------------------------------------ppavladllaaa..ln
00459091   1/1  ----------------------------------------------------------------------
00475811   1/1  ----------------------------------------midlrsdtvtpp..tpevleamaea....n
00528621   1/1  -----------ladrlknlppsitlallalalellaggkdvidlsvgep.dfppppavlealaealdgll
00462061   1/1  ---------------------------------------------rqvggivlilsenappfyvpeavld
00354011   1/1  Ms...sflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpplldllgltlplpavle
00527311   1/1  ----------------------------------------------------kkiplgspvfdeeeiaav
00445231   1/1  -------------------------------llellaaellaggpdvidlsvgep.dfppppavlealae
00479561   1/1  -----------------llppspilsllelaaelgaggkdvidlsvgep.dfppppavlealaeald..g
00357001   1/1  -----------------------------------------kplvylfsaGPaplppevleamlkelldl
00509771   1/1  -------------------------------smdlserlsrlpsyireilelaaelgadgkdvidlgvge
00423831   1/1  ------------------------------------------------------llkivdllnekvldvl
00460891   1/1  --------mmllsdrlldlkpsvilkllalaaelgaggpdvidlgigep.dfppppavlealaealdeg.
00462551   1/1  -----------------------------------------vidlsvgep.dfppppavlealaealdgl
00456391   1/1  mslfsrlkalppspilellelakel...........pgpdvinlgigvyrdeepdlptppavkealkeal
00450681   1/1  ------------------------------------mlsllsnlkplppdpilglleaakadpgpdvinL
00519931   1/1  -----------------------------------------kpliyLdgpgptplpprvleamaryl...
00405261   1/1  -------------------------------mslttlrvaelakrlanlvpsgilrvladelkaegkdii
00355861   1/1  -------------------------------------------kvylfsaGPaplppevleaaakellny
00503401   1/1  -----------------------------------------mplvylfsaGPaalppevlealaeellny
00452311   1/1  -----------lnsllsslppyppdpilglaaalkadgrpdvinlgigvyrdeepdlppppavrealaea


                         -         -         *         -         -         -         -:140
query           VGSGGSGHISGYSVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
00460071   1/1  lgsggsrllygtnplheeleealaellgaeaallfnsGteAnlaalkallgpgdivivdeltHgstldgl
00467471   1/1  aldkygvgspgsrllygttplhdeleerlaellgaeaalvfnsGteAnlaalrallgpgdivlvdelnHg
00520701   1/1  ealekygvgsggsrlsygttelleeleealaellgaeevlltssGteAneaallalralgpgdevlvdel
00358461   1/1  a....lgaalggldllygpsggileleealaelfgaddaifvtnGtseanlavilallgpGDevlvdrps
00401341   1/1  ealleallnkygegnpgsryyggtlyvdplveeleerlaelfgaeaalvftnsGtaAnlaallallkpgd
00364061   1/1  eallealenkygegypgsrlyqgtlsvdpleeeleerlaelfgaeaailltnsGtaAnlaallallkpgd
00459731   1/1  ygegypgsrlylgteavgplveeleerlaelfgaeadelgvavftssGtaAlllallallkpgdevlvps
00461541   1/1  egypgsryyggteyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaallallkpgdevltpsle
00516011   1/1  glgvlnlGhs.hpevveaikeqldklghvsfgf.....ttepavelaekLaellpaglekvfftnsGseA
00521571   1/1  dklghvs.......gttelavelaekLaellpglekvfftnsGseAneaalklaraytgrdkiisfeggY
00501571   1/1  drlgngssyg.....ptpgveelrealaellgadpaevlftnggteAlelalkaarllgpgdevlvpepa
00428091   1/1  eqldrllhgsflg....gltelavelaerlaellplgldrvfftnsGseAneaalklarayalakgtprd
00485711   1/1  plvivraegaylydvdGnrylDflagigvvnlGhn.hpevveaiadeeqldkllhvallsngaphepaee
00465841   1/1  gngssghrlsrgatelveelreklaellgadpeeviftssgtealnlalkalrlgpgdeilvsalehpsv
00497541   1/1  .gllgyppsqglpelrealaellaellgadldpetevlltsggtealelalrallgpgdevlvpdptypg
00380341   1/1  eaviealagggtgydysrgpnpt...vealeealaellgaeaalvtssgtaAillallallgpGDevlvp
00529431   1/1  neylDflsglgvlnlGha.hpevvealkeqldrlghvs.......gttepavelaelLaellpglekvff
00502611   1/1  gpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlelalrallgpGdevlvpdptyh
00517571   1/1  qtspevieaaeealggygysrggdpl.......reeleellaelfgaeaalvtssgtaAillallallkp
00473401   1/1  nplsggeysrganptleeleealaellgaeealltsggtaailaal.allkpGdevivsdpaygstlall
00461651   1/1  eavlealaealasghlyg......ygpgpgveelrealaellgaeevlltsggtealelallallkpGde
00448071   1/1  .....ghlsygategleelrealaellgadpayevvftsggtealeaallallkpgdevlvsapghpsvl
00511951   1/1  tp.pfpvpeavlealaealaggrygyggnpg.......veeleealaellgaeealvtsggtaaillall
00453921   1/1  qleklgytss.....ggttelaealaellaellpldrvfftnsGseAnelalklarayylakgrlgtggd
00480741   1/1  ........hrsgygytelleelrellaellgadedaeevlltsggtealeaallallkpgdevlvsdpah
00417041   1/1  .....sgwlygtgpgveeleealaellgaeeavftssgteAlnlallalglgpgdevivpspthvatlaa
00489521   1/1  agllpdvllatgadviplgqgepdvppaveealallgagatgygysrgtgplrealeerlaellgaeevl
00533351   1/1  iyldpepdlppppavlealaealdd.gagllgypdpaGlpelrealaellarlfgvevdpeeiaalltng
00412601   1/1  ealdggrygrgpnpgleeleealaellgaeevlltsggtaaif.allallgpGdevlvpaplygsylala
00460561   1/1  eamaealeeyygnphsgghelgrgalelleelrerlaellgadspdevvftsggtealnlallalaaahl
00494861   1/1  gnygsdpg.......leelrealaellgaeaaeivftsgGteAnllallalldpgdevlvsepahpsvle
00367801   1/1  vlealaegltgytysr...ggnplrealeeklaelegaeealvtssgtaAieaallallkpGdevlvpep
00507541   1/1  gvssldelfdpipleirrgeglplpdlserevldelsglasknlgvdplfyldgaattpvppavlealae
00408971   1/1  .ytrgpg........vaeleealaellgaehavatnsgtaAlllallalglgpGDeVivpaltfvstana
00487471   1/1  -----------------deleealaellgaeealvtssgteAlelallallkpGDevivpsptygatlea
00421441   1/1  lfgnphslghelsrgatplleelrellaellgadpaeivftsggtealelallalrayglkpgdevlvss
00523021   1/1  ----mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaafealesgyiysriggptveeleea
00370391   1/1  aeGypgkryygGne.yvdelEdlaieralelfglepalwfanvqphSGsqAnlavllAllkpgdtilgld
00503901   1/1  ...galllrypdpaglpelreaiaellgrrygvdvdpeeeilvtnGgtealelalralldpGdevlvpdp
00500761   1/1  .....ddlgygadplveeleeklaellgaeaavlftsgGteAnllallaarepgdevivsataHisvlea
00355891   1/1  ........llgygpppglpelrealaellgarygvavdpeeivvtnggtealelalrallgpGdevivps
00375691   1/1  danenplgpslaaldag....llrypdpglpelreaiaellgvdpeeilvtnGatealalllrallnpgd
00440831   1/1  gpvltaqlaellpgdryyggnpgv....deLeerlaellgaehavftnsGteAnllalkallkpgdeviv
00416741   1/1  ........llrygdptglpelreaiaellgrrrgvavdpeevvvtnggtealelalrallgpGdevlvps
00517231   1/1  iAseNyl....spavlealgsvltnkyaegypgkryygGteyvdeieelaieralelfgadyllwganvq
00469651   1/1  ......llgygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalrallgpGdevlvpsp
00428061   1/1  vyldlepdlppppavlealaealee........gllhgYpppaGlpelreaiaelllrrygvgldperva
00393411   1/1  ........llgygpspglpelrealaellgarygvavdpeeivvtnggtealllallallgpGdevlvpd
00460871   1/1  lpamyaalevgddyygggpt...........vdeleervaelfgaehavfthsGtaAnllallallkpGd
00465471   1/1  gnpssghelgygatelleelrealaellgadpdeiiftsggtealnlallalrrallkpgdeilvsspeh
00507531   1/1  aslrrkgllllpglselevlrhltdlagknygddliylglgalgh.kppavieallealegltaytpyqp
00506961   1/1  ggall....lgygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalrallgpGdevlvps
00490701   1/1  yangpsghelgrgalelveelrerlaellgadpaeivftssgtaalnaallalgaallsplkpgdevlvs
00470951   1/1  ihhlgp....eftelveearellaellgadpgeevvftgggtealeaallgllkpgdkvlvssnghfsvl
00451711   1/1  ed..gltlgYgppeglpelreaiaellarygvgvdpeevvvtnGgtealalalrllallnpgdevlvpdp
00513231   1/1  alllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllralldpGdevlvpsptYpg
00495241   1/1  liyldnaattplppevleamleallellgnphssgyslsrganplveelrerlakllgaddpeeivftsg
00474411   1/1  .....shrsyeftagleelrealaellgadpdvvlltgggtealeaallallgpgdkvlvpapgyfsvrl
00445951   1/1  p.dlpppeavlealaeal........ggllgypdppglpelreaiaallgvdpeeivvtsGatealnlal
00521641   1/1  ptplppevleamleal.......ishrspeftelveearellaellgadpyeeivftgggtealeaalln
00435831   1/1  vlnlGh.nhpevveavaeqldkllhvs....flglttepavelaellaellpgglldkvfftnsGseAve
00460241   1/1  ....dgagllgYpdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgtealllalralldpGd
00389521   1/1  ealaeald....gllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllralldpG
00507681   1/1  delglgllgYpdpaG....lpelreaiaeylarrrgvpdpeqilvtnGatealalllralldpGdevlvp
00352461   1/1  sgtsaasdaqlaallvgddayg......gdplafeleealaelfgldavlftnsGteAnelalkallayh
00476701   1/1  qnlltyelspgateleeevadwlaellglpvaflllgadpaggvftsGgteAnllallaardralprrka
00459091   1/1  ----------ksdliPdfptipeeeieavaealdsgilsytlgpgvkelEeaiaellgakyalavssGta
00475811   1/1  vgddv....ygedptvneleerlaellgkeaavfvpsGtmanllalaallqpgdevlcdelaHilldeag
00528621   1/1  gypppaglpelreaiaeylerrygvgvdpenilvtnGatealflalrallnpGDevlvpdptYpgylaaa
00462061   1/1  alteayaegfagyrggygysrlrnptaealeralaalegaeevvltssgtaAialallallkpGDevlvs
00354011   1/1  alaealaeg.....llgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatealelalralldp
00527311   1/1  lealdsgvyt.lgptvdelEealaallgakyavavssGtaAlllallallglgp.dgkeVivpsltfvat
00445231   1/1  alddg.........vlgyypdpglpelreaiaellgrryvdpeeilvtnGatealalllral...gdevl
00479561   1/1  ........llrypdpglpelreaiaallgvdpeeilvtnGatealalllral..pgdevlvptptYpgyl
00357001   1/1  lgnglsvleishrskefteileearellaellgapddyevvlltgggtaaleaallnllgpgdkvlvlvt
00509771   1/1  pdlldfppppavlealaealddg.........llgYpdpaGlpelreaiaellkrrrgvgvdpeqilvtn
00423831   1/1  gsevldellpkyelPeeglsleevlellkdllsldgnpllprflgavtsmpaeaaelltealnknlldpd
00460891   1/1  ........llgYppglpelreaiaeylkrrygvgvdpdeilvtnGatealflllrallnpGdevlvptPt
00462551   1/1  lgyypsaglpelreaiaeylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsPtYpgylaa
00456391   1/1  ee....gltlgYlpiaGlpelreaiaelllrrygldldpdrivlvqtlsttGatealalllrallnpgde
00450681   1/1  gigvyrdeepdlppppavkealaealedgllllrYppiaGlpelreaiaelllgeygvgldpervaivvt
00519931   1/1  ........ihhrspeftelleearellaellgakndlkyteiiftgsgtealeaalanlllllkpgdkvl
00405261   1/1  klsagep.dfgppdeiteaaaealdqgstfleesleeaaelfallvsgwlrlsyiygyypnpglpeLrea
00355861   1/1  qgngasvleishrskeftaileearallrellgapedyevlflsGggtaafeaallnllgpgdkvlvlvt
00503401   1/1  ngvgrsvlelshrskefteileearellrellnapddyevlflsGggtgafeaallnllgpgdkvlvlvt
00452311   1/1  ledgelllgYppiaGlpelreaiaellfgryglgldpdriatvvtnGatealslalralkrflkgklnpg


                         +         -         -         -         -         *         -:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
00460071   1/1  rlsgakvvfvphndlealeaalaeatprtkavvvesvfsptGdiaplaeiaelarkhgallivDeahagg
00467471   1/1  stldglrlsgaevvfvphnDldaleallkelreegpkpkliivegvfsmtGdiaplkelreladkygall
00520701   1/1  ahhsildgarllgaevvvvphndldaleaalteagpprtklvvlesvnnptGtiaplkeiaeladeygal
00358461   1/1  HksilnggarlaGakpvylptdrngfggiggirfkhldpealeealtelkpeglrplpktkavvltnpnp
00401341   1/1  evlvpslahgstlaaarlagakrlgievvfvdvdpetglidlddleaairp...rtklivleh.snptGr
00364061   1/1  evlvddlahgstlagarlanasglGaevvfvpvdedglidledleaal.ke..ktklivles.snptGvv
00459731   1/1  lahggstlaaarllGagvnfsgllfkvvfvdvddetgnidledleaaite..pktkaiiv..vasnpGvi
00461541   1/1  hgGhlthgstfdatalalsglgaepvfydvdpetglidpdaleealrert...paiivag.vsaygrlad
00516011   1/1  neaalklaraytgrdkiisfeggYHGrtlgalsltgssyiegfgpllagvvhvphpdtyrlpyndeleel
00521571   1/1  hGrtlgalsltgspadrlgfapllggvrlpapdtyrvpyndlealealleelgddiaavivepvqgegGv
00501571   1/1  yHgstlaalrlagakvvevtfvpldpdglllpypdlealeaai.tp..ktaavileppqnptGvvlpspe
00428091   1/1  kilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldaleallaehgeki
00485711   1/1  laeklaelapegldkvfftnsgseaveaalklarqyglglggsrlvlgtlelheeleellad.tgrekil
00465841   1/1  leaarllaerlgaevvfvpldeevdglldlealeaaltp...ktklvvlehvsnetGvilplkeiaelak
00497541   1/1  ylaaarllGaevvfvpldedgflldlealeaalte...ktkavileppnnptGvvlpleeleelaelare
00380341   1/1  dplygstielfglalrlaGaevvfvdlddlealeaai.tp..rtklvvlespsnptgtvadleaiaelah
00529431   1/1  tnsGseAneaalklaraytgrdkiisfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvpy
00502611   1/1  gylaaarllGaevvfvpldedgldlealeaalteagadgllpktkavilepnpnnptGvvlppeeleala
00517571   1/1  gdeilvsrglyhgslihglklsgakvvfv.d.dledlekaike...ktklvvl..psnptgrilsledlk
00473401   1/1  rllleraGaevvfvdlddlealeaai.tp..rtklvllespsnptGtvldleeiaelahehgalvivDea
00461651   1/1  vlvpdptypsylaaarll.aevvfvpldedggldlealeaait.p..ktklvvlenpnnptGvvldleei
00448071   1/1  laeaaerlGaevvvvpvdedglldlealeaaleeh..rtklvilehvnnptGvvlpleeiaelarehgal
00511951   1/1  allkpGDevlvpapaygsylallrlllkrfGaevvfvdlddlealeaai.tp..ktklvvlespsnptgt
00453921   1/1  kilvfeggYHGrtlgalsltgspsylggfgplgagvvvvpypdlealeaaie....pdtvaavivepvqg
00480741   1/1  gstlyakaakllGaevvfvpldedglidlealeaaiteg.pktklvvlehpsnptGvvldleeiaelake
00417041   1/1  illlGakpvfvdvdetgnidlealeaaieehtpk...tkaii...vvnptGvvadleeiaeiakehgill
00489521   1/1  ltsggteAlelallallkpGdevlvpdptypstlaaarll.akvvgvpvdedggldlealeaaie..tpk
00533351   1/1  gtealelalralrklgpgdevivpsptypgylaaarlaGakvvfvpldedgtfgidlealeaaiteapk.
00412601   1/1  rlalkrlGaevvfvd.ldledleaaite...ktklvflespnNptgtvldleeiaelakkhllnpgalvv
00460561   1/1  kpgdevlvsalehpsnlaalrllaerlGaevvvvpvdpdglldlealeaal.dp..rtklvalthvsnvt
00494861   1/1  agaaellGakvvpvp.dedgkldledleaaitedtahgllpklvvltnpnnptGtvyslepleeiaalak
00367801   1/1  lygstlellralakllGaevvfvdlddledleaaitp...ktklvllespsnptgtvldleeiaelahen
00507541   1/1  alt.agnpysphelsqgaleleeelaerlaellgadaaivftsggteAnllallaarryhrargelgpgd
00408971   1/1  vllaGakpvfvdvdpdtfnidpealeaai.tp..rtkaiv...pvnptGavadleaiaelarehgllviv
00487471   1/1  irll.akpvfvdvdedggndlealeaaitp...ktkaiilehpsnptGtvldleeaiaelakkhgilliv
00421441   1/1  lehgsvlraaellerlGaevvlvpvdpdgrldlealeaaidpn...tklvvlehpnnptGvvlpleeiae
00523021   1/1  laellgaeealltssgtaAlllallallkpGDevivpaptygstaeairlllkrlGakpvfvdldedlea
00370391   1/1  lshGghlthgsildgtklslsgklfevvpygvdpetglidydeleklarefkpkliiag.vsaygrladl
00503901   1/1  tYpgylaaarlaGakpvfvpldedgllplllglendflldlealeaaitp...rtkaiilpnpnNPtGav
00500761   1/1  gailglggakvvlvpvdedgkldleaLeaairedtahvhgtrpvlveitgntetGtvysld....eleei
00355891   1/1  ptypgylaaarllGaevvfvpldpdgtfgldlealeaai.tp..rtkaiilenpnNPtGtvldleeleal
00375691   1/1  elvlvpdptYpgylaaarlagaevvpvpldedfgldlealeaal..p..ktklvvlpnpnNPtGtvlsle
00440831   1/1  pdlayggtteagllagakpvfvdvdedgnldlealekaitevgaektkaiileppanptGvlplspadlk
00416741   1/1  ptypgylaaarlaGaevvfvpldedngfgldlealeaaitp...ktkavilenpnNPtGvvldleeleal
00517231   1/1  phSgsqAnlavllallkpgdtilglslahGGhlthgslidgvrlsasgkglevvpygvdpetglidydel
00469651   1/1  typayaaaarlaGakvvfvpldeeggflldlealeaaitp...ktkaillpnpnNPtGavlsleeleela
00428061   1/1  ivvtnGgtealalalrllallnpgdevlvpdptypnylaiarlaGaevvevpldeendfgldldaleaal
00393411   1/1  ptypaylaalrlaGaevvfvpldpdggflldpealeaaitp...ktklvllvnpnNptGtvldleeleal
00460871   1/1  evivpdhflahggfletggaallsgatpvfvdydlvdpdtgnidlekleaaikevgapktkliilenpvn
00465471   1/1  psvlkaaellerlgaevvevpvdedgrldlealeaalde...dtklvvlthpnnptGvilpleeiaelak
00507531   1/1  elsqgalelleelqerlaellgadaanvvltdggtaaleaallalrltpgdevlvpdgahpsnlaalqtl
00506961   1/1  ptYpaylaaarlagakvvpvpldefgldlealeaalteakekgpktkaiilvpnpnNPtGavlsle....
00490701   1/1  alehgsvlaalallaerlGaevvfvdvidlealeaal.tp..dtklvllthvsnptGvlldieaiaalah
00470951   1/1  laeiaerlGaevvvvpvdegglvdlealeealke..pktklvalthvenstGvinpleeiaelahehgal
00451711   1/1  typgylaaarlagaevvpvpldeengfgldlealeaalaeatektkllllnnpnNPtGavlsre....el
00513231   1/1  ylaalrlagakvvpvpldelltggllseggflldlealeaai.tp..ktkliilnnpnNPtGtvlsreel
00495241   1/1  gtealnlallalalaglkpGdevivsapehpstlaawrllaerlGaevvfvdvdedglidlealeaai.t
00474411   1/1  aelaerlgaevvvvpvdpgglvdpeale......tpdtklvllthpenptGvvldlaaiaalarehgpda
00445951   1/1  rallgpGdevlvpsptypaylaalrllGakvvfvpldleedgflldlealeaai.tp..rtkaillvnpn
00521641   1/1  llkpgdkvlvssnghfsvlaaeaaerlGaevvvvpvdpgglvdlealeaalee..pdtklvalthvetst
00435831   1/1  aalklaraytgrtkiisfegayhGrtlgalsltgsgllrapfgpllpgvvhvpapllyrlllleyndlea
00460241   1/1  evlvpdptYpgylaaaelaGaevvpvpldeeggflldldaleaaitp...ktklivlpnpnNPtGtvlsr
00389521   1/1  devlvpdptYpgylaaarlatgaevvpvpldeeggflldlealeealtealkegpktkalllpnpnNPtG
00507681   1/1  sptYpgylaaarlagakvvpvpldgfgldlealeaalkeakeatpktkliylvpnpnNPtGavlsleele
00352461   1/1  rakgepgdtviisngyhgttlehvslagakvvrvpfdpaldealllpedgnldledLeklikehgad..n
00476701   1/1  eglaalgleglpglvilvsdpaHysvekaarllGlgvrlvpvdengrmdleaLeeaieedtaaglipaav
00459091   1/1  AlllallalglgpgdeVivpsptfvatanaillagakpvfvdvdpdtfnidpedleaaitp...ktkaii
00475811   1/1  aleflsgaklvplpgedgkldpedleaairdddvhfprt.......rlvslentqntegGtvypleelee
00528621   1/1  rlagakvvpvpldedgflldlealeaaitpktklillpnpnNPtGtvlsleelealaelarkhglllivD
00462061   1/1  dplyggtltllrllgarggivvtfvdgldlealeaaite...ktkliflespsNptgtvldlaaiaelAh
00354011   1/1  GdevlvpdptYpgylaaarlatgaevvpvpldeeggflldlealeaalteapegglktklvllpnpnNPt
00527311   1/1  anaillagakpvfvdvdpdtnidpedleaaitp...ktkaii...pvnllGqvadldeiaeiakkhglll
00445231   1/1  vp.PtYplyaaaarlagaevvevpldngflldle...itpktkllllnnPnNPtGtvlsreelealae.h
00479561   1/1  aaarlagaevvpvpldndfgldldaleaaiktp..ktkllllcnpnNPtGavlsreelealaelarehgi
00357001   1/1  ghfgnraadlakrlgaevvvvpvdegglldleeleaalidp..dtklvalthnetstGvlnpl.....la
00509771   1/1  GatealalllralldpgdevlvpdptYpgylaaaelagakvvpvpldeeggflldlealeaaltpktklv
00423831   1/1  ..vspgtaeleeevvsmlarllgapadnleealGaftsGgteanllallaarnralpkrkaaglgipgpe
00460891   1/1  YpgylaaarlagakvvevpldeegglflldlealeaaitepktkllllcnpnNPtGavlsreelealael
00462551   1/1  arlagakvvpvpldeengflflldlleleaaitpktkllllcnPnNPtGavlsreelealaelarkhgll
00456391   1/1  vlipdptypnylaaaklagakvvpvpldeengfgldlealeaaleeatektkllllnnphNPtGavlsre
00450681   1/1  nGatealllaarflallnpgdevlvpdptypnylaiaklagaevvpvplddengfgldleallaalteap
00519931   1/1  vsanghfsvr.waeiaerlgaevtvllpvdwggpvdleeieealde..pdtklvalvhvetstGvlndik
00405261   1/1  iaallggvyglavdpenivvtaGatealslallalldnltnlllkpgdevvvpdptYpgylrlakllgak
00355861   1/1  ghfsvraaelakrlglevvlvldaeagglvdleeleealidpdtklvalthnetstGvllpieeia....
00503401   1/1  ghfsnraadeakrlgaevvvldaddgglldleeleeallnp..dtklvavthneTstGvlnpleei....
00452311   1/1  devlvpdptypnylaiaelagaenvvevplddendfgldldallaalekatpktkllllnnpnNPtGtvl


                         -         -         -         +         -         -         -:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMPPAQAQALSASL
00460071   1/1  vlgrtgrgllellglgadivvgtlsKalGgrgGavlgseelidalrplarggtfsgslnplaaaaalaal
00467471   1/1  ivDeahaggvlgatGrgllehlgvlpdadivtgtlsKalgggrgGailgskelidklrslarpgifstsl
00520701   1/1  livDeahaggvlgrtgrglaehlgvepdadivvgtlhKalGprgGalagseelidalrplarggtfsgtl
00358461   1/1  tGtvypleeiaelakkhglyllvDeAhgagayggpgrglaehlglpplaleagadivvgslhKtlgaltq
00401341   1/1  vadleeiaelaheygallivDeAhaagllalglhglple...gadivvgslhKtlgGprgGailvrdela
00364061   1/1  adlkeiaelaheygallivDeahaagllgldgrppgel...gaDivtgslhKtlgGprgGyiagkdelqe
00459731   1/1  adleeiaeiakkhgallivDaAhalgavgldvlp....gplggaDivsfslhKtlggppGGallvndeli
00461541   1/1  lkelreiadevgallivDaAhaaGlvaagvlpspfg...gadivtftthKtlrGprgGailtrdelldel
00516011   1/1  gllllealeelleelgpddiaavivEpvqgegGvivpppgylkelrelcdkygillivDEvqtGfgrtgk
00521571   1/1  ippppgylkalrelcdkygallivDEvqtgfrtgk..lfafehfgvvpdiv..tlgKalggGlplgavlg
00501571   1/1  yleelaelarehgallivDeayagfgrtglpfap..ealgv..divigslsKalg.gglglGavlgsdel
00428091   1/1  aavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgfgrtgk..lfafehagvtpdiv..t
00485711   1/1  vfsggyhgntlallaltgpgdevlvpdplypgylhaallagarvvfvpldvdedghldlealeaaleeld
00465841   1/1  ehnGdlsallivDaaqavgalgldlagl......gvDivvfslhKalggpggiGalyvrkelldrlrpll
00497541   1/1  hgillivDeayagfvytgklpvslaellgvagadivvgSfsKalglpGlrlGalvgdeelidalrklrrg
00380341   1/1  khgalvivDeayatgvlgd.....plalg..adivvgslsKalggpgdrlgGyvvgsdeliealrklrlg
00529431   1/1  ndlealeallaehgdeiaavivepvqgegGvivpppgflealrelcdehgallivDEvqtGfgrtg...l
00502611   1/1  elarehgallivDeayagfvytgkpagslaaldelgvdivlgslsKtlggglrlGalvgdeeliealrkl
00517571   1/1  eiaeiakeygallivDeahgaglvggpllpsplelg..aDivvgSlhKtlgGprgGyiagkkelieklrk
00473401   1/1  yaagllgd.......plelgadivvgslsKylgghgdlraGylagreelidklrgllvglgggt.lspaa
00461651   1/1  aelakelghgallivDeayalgvl.gdplel....ga..divvgslsKtlngpgGlrgGalvgndeliea
00448071   1/1  livDeaqalgal..pgdldal....gvdivvfslhKalggglglGallvseellerlrpllsggtslyld
00511951   1/1  vldleaiaelahehgallivDeayaagvlgd.....plelg..adivvgslsKalggpgdlrgGylvgse
00453921   1/1  egGvivpppeflkalrelcrkhgillivDEvqtgfgrtgk..lfafehlgvt..pdivtlsKalgggglp
00480741   1/1  hgallivDaayaagalpldplel......gaDivvfslhKalggppgvGallvrkelieklrpllpggll
00417041   1/1  ieDaaqalgalygglk..aggfg.gadifsfslsKtlgggggGalltndeelaerlrplrlggisidlky
00489521   1/1  tkavilespnnptGvvldleeiaelakehgallivDeayaggal.gdplel......gadivvgslsKal
00533351   1/1  ..tkaiilepnpnnPtGvvlpleeleelaelakkhgillivDeayagfaydlggkgpsllelldlgpdvi
00412601   1/1  vDeayatpvlgd.....plelg..adivvhSlsKalggagdlriGyvvgndelidalrklrgp.ltgstl
00460561   1/1  GvilplaeiaalahehgalvlvDaaqaagalpldlgel......gaDfvvfsghKllGppGvGflyvrke
00494861   1/1  ehglllhvDgayaggalpglgvsvaeldgaegadvvsfslhKtlggpggGallvrdelaealpllrgggg
00367801   1/1  hgalvivDeayaagvlld.....plelga..divvgslsKylggpgdlrgGyvagseeliealrklrpgg
00507541   1/1  evlvpdpaHgsnlaaarllGaevvevpvdedgridlealeaai.de..rtaavvltnpnnptGvieplee
00408971   1/1  Daahalgalyggrhpgsl..ga..divsfsasKtltggggGavvtndeelaerlrklrnhglsrgllllv
00487471   1/1  Deayalgvlgdp.....lelga..divvfSfsKalgGptGlrgGalvgndelieallkllrggggggtls
00421441   1/1  lahehgallivDaaqaagalpldlgel......gaDivvfsahKylggpglGallvrdellerlrpllhg
00523021   1/1  leaaitpk...tkaiilehpsnptGtvadleaiaelakkhgilvivDeaqatggllydglelg......a
00370391   1/1  krlreiadevgalllvDaAhiaGlvaagvhpspl...eyadvvtttthKtlrGprGGliltrdglklvsl
00503901   1/1  lsreelealaelarkhglllieDeayaelvydgkpfpslasldgeygrvivlgSfsKtlglpGlRlGyvv
00500761   1/1  aelcrehglllhvDgArlgnalgalgvdlaeldgaegaDsvsfslhKglgapgggallgrdeliekarll
00355891   1/1  aelarehglllivDeayaglvydgklpgslaeld.gvdivlgsfsKalglpGlrlGylvadpeliealrk
00375691   1/1  eleelaela.khgalvivDeayaelvyggpllslldllg..rvivlgslsKtlglaGlRvGylvappeli
00440831   1/1  aireiadkhgillivDeahaaglaytgklfgseyagvaigelvpdlfggadivsfslsKtlggprgGail
00416741   1/1  aelakkhglllivDeayaglvydgkplsalalldalgrvivlgSfsKalglpGlrlGylvadpeliealr
00517231   1/1  eklakehk..pklivag..aSaygrladlkrlreiadevgalllvDaAhiaGlva...ggllpsplegad
00469651   1/1  elarehgllvieDeayaelvydgkpapslasldglldrvivlgSfsKtfglpGlRlGylvappeliealr
00428061   1/1  teapektkllllnnpnNPtGtvlsleelkalaelakehgillvvDeaYagfafggeedapsilelagagp
00393411   1/1  aelarehgllvivDeayaelaydgrpapsllsldpdalgrdivvfSfsKtlglpglrvGylvadpeliea
00460871   1/1  paGgsvysladlkaireiAdkyglllivDaAraagalyaggvtgspyafrsigeivdeifgyadivsfsl
00465471   1/1  ehgpdallivDaaqaagvlpld......ldelgvDfvvfsghKalgppgiGalyvrkell......lrpl
00507531   1/1  aallGaevvvvplddlealeaalde...dtaavllehp.nptGvvldlaalaelahaaGallivDaaqaa
00506961   1/1  eleallelarkhdllvieDeayaelvydgkpfpslasldepdrvivlgSfsKtl.lpGlRlGylvappel
00490701   1/1  ehGallivDaaqaagll......pldvgelgaDfvvfsghKtlgggppglGflyvreellerlppllfgg
00470951   1/1  livDavqslgalpidvdel......gvDflvssshKglggppGlGflyvsekalerlknrklpplsgggd
00451711   1/1  eelaelakehglllivDeayaglvyggeedapsllaladalprvivlgSfsKtfglpGlRvGylvappel
00513231   1/1  ealaelakkhglllisDeayaelvydgapftsllslpdaldrvivlrSfSKtfglpGlRvGylvappeli
00495241   1/1  p..kTklvalvhpsnptGvvlpleeiaelahehgalvivDaaqaagalpid......ldelgaDfvvfsa
00474411   1/1  llvvDaaqslgalp......ldldelgvdvvvgslqKalggppglGflav...spellerleplsgylgl
00445951   1/1  NPtGavldleelealaelarehgllvieDeayaelvydg.pfpsladldagrvivlfSfsKtlglpGlrv
00521641   1/1  GvllpleeiaelahehgallvvDavqslgalpid......vdelgvDllvasahKglggppGlGflyvse
00435831   1/1  lealieellgpdtiaavivePvqgnggvivpppgflkalrelcdehgilliaDEvqtgfgrtgk..lfaf
00460241   1/1  eeleelaelarehgillivDeayaelvydgepkdalppslasldglgrvivlgsfSKtfglpGlRlGylv
00389521   1/1  tvlsleelealaelarkhgillivDeayaelvfdgppfpslasldgallllpldlgrvivlgSfSKtlgl
00507681   1/1  allelarkhdllvieDeayaelvydgapfpslasldapdrvivlgsfSKtl.lpGlRlGylvappeliea
00352461   1/1  iaavileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfgfgrtgslfaleiagivpdi
00476701   1/1  vatagttptGaidpleeiaeicrehgiwlhvDaAygggalpfpeyrllldgiegaDsitfslhKwlgvpl
00459091   1/1  ...pvnptGnvadldaiaeiakkhgllvieDaayalgalyk.gkkvgsf....gdivvfSfsktKnltgg
00475811   1/1  iaelArehglllhlDGARlanalvalgvslaelag.lvdsvsvglsKglgapvGavlvgdkdliekarrl
00528621   1/1  eayaelvfdgepppsl.ldalgrvivlgsfSKtlglpGlRlGylvappeliealrklkspltlgvsslaq
00462061   1/1  evgallvvDntyaapll.......ldpldlgadvvvhsttKklgghggvrgGylvgnpellaallkvlpr
00354011   1/1  GtvlsreeleellelarehglllivDeayaelvfdgapfpslaslllelglrllpdaygrvivlgsfsKt
00527311   1/1  ieDaaqalgalyk.gkklgsfgdivvfSfhatKnltggegGavvtndkelaeklrllrnhgisrdglrky
00445231   1/1  gllvvsDeaYadlvyd...salllleaydnlivlrsfSKafglaGlRlGylianpeliealrklrsplnv
00479561   1/1  llivDeayadlvydgasfvslasll.dnvivlrSlsKafglaGlRlGylvappeelieallklrs....p
00357001   1/1  kkhgallivDavssilarp.........idvdklgvdyasaqKnlGppGlgvvivsedllerlepilpgy
00509771   1/1  lltnPnNPtGtvlsleeleallelarkhgllvisDeayaelvydgpfpslasldgydrvivlgsfSKtfg
00423831   1/1  ilvs.paHysvlkaarllgie.vrlvpvdendgrmdlealeaaiden...talvvatagttptGaiddie
00460891   1/1  arkhdllvisDeaYadlvfdgapfpslasllpdlydrvivlrslSKtfglpGlRlGylvapnpelieall
00462551   1/1  visDEiYadlvfdgepppsllldaydrvivlrslSKtfglaGlRlGylvapnelirallklrspltlgvs
00456391   1/1  ....elkelaelakehdlllisDeaYqgfvydgleedavsiaslaelgdrvivlnsfSKtfglpGlRvGy
00450681   1/1  ektkllllnnpnNPtGtvlsreelkelaelakehglllivDeaYqgfaydgldedalavrsflelldagd
00519931   1/1  eiaelakelshgallvvDavqslgalpidvdel......gvDflvassqKgllgppGlgflyvseraler
00405261   1/1  vvfvdl.dlealekai.tp..ktklvflesPnNPtgtvld.......akehgilvivDeaYaepvydp..
00355861   1/1  ehgallvvDaassigs.....rpidvs...gvdvvvasaqKnlgppGlgvlivsedllerlepilpsyld
00503401   1/1  .dhgallvvDavsslgslpidv........dklgvdffsaqKnlGppGlgvlivskdllerleplgpsyl
00452311   1/1  tpeelkelaelakehgllvivDeaYqgfayggldedapsllalleagenvivlrSfSKafglaGlRvGyl


                         -         *         -         -         -         -         +:350
query           AVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRP
00460071   1/1  elleeegleelrerlaelaarlregLaelglevvpglglivpvelgdgldalalaeallerGilvrpisy
00467471   1/1  nplaaaaalaalelle..egeelrerlrenaeylregLeelglpvgpsdghivlvdlgdgllakalaeaL
00520701   1/1  nplaaaaalaalellgeegleelrerlralaaylaegLaelglpvvgglgaivlvdlgdgvdakalaaal
00358461   1/1  tGwlhvrggyiagpkelidalrfnraysllystspsyplqaallaalellageegeelrerlieladylr
00401341   1/1  eklrsllfgggfggtlspllaaallaalellee.glkerrerlvenaarlaeaLeelgfvvvvgppdghl
00364061   1/1  lieklrrlkaplgfgtalspliaaaalaalelle.egleelaerlvenaaylaegLkelgfvvvvgppgg
00459731   1/1  eklrplrvgglfdlekligrarryffsgtppgarlaalaaalgllglegleerlerrrelakylaegLke
00461541   1/1  lrllrgfgfdlakkinsavfpglqggplnhviaalaaalklaqleefkeyaeqvvanaralaeaLaelgf
00516011   1/1  ..lfafehfgvvpDiv..tlgKalg.gGlPlgavlgskeimdalrpgsflhggTfsgnplacaaalaale
00521571   1/1  seeiadalrplgpglhgstfsgnplacaaalaalellee...egllerlaelgaylregleellakhplv
00501571   1/1  adalrplrrgltfgg..nplaaaaalaalellee...eelrerlreladylaegLaelglelvgpvrggg
00428091   1/1  lsKalgggglplgavlgseeiadalapgalgaflhggtfggnplacaaalaalellee...edllerlae
00485711   1/1  aggdrtaavilepvqnptGvvlppeeylkelrelarkhgillivDeayagfgrtgkpf..alellgvddr
00465841   1/1  hgggslilvvrfdsltlqelglrfefgt.ppvaaaaalgaalelleeeglleairerlreladylregLe
00497541   1/1  gtft..lsplaqaaalaaledl.eehleelrerlrelrdrlaeaLeelglevlvpggglflwvdlpdllg
00380341   1/1  ggfggtlspaaaaallrgletl.....elrrarlrenadllaeaLaelpgvvlvlypglpshpghelakr
00529431   1/1  fafehfgvtpdiv..tlgKalggGlplgavlgsaeimdalapggpglhggtfsgnplacaaalaalelle
00502611   1/1  rhggtf..tgnplaqaaalaaledlaleehleelrarlrerrdrlaeaLeellpdlpglevvgpggglfl
00517571   1/1  ..vfpglggspsplvaaallaalktlllrgfkryleealklakalaeylyeglkklpglegfkvvspggg
00473401   1/1  aaallaale.....tlelrreralenadylaelLaelpgvylvgypglpshpghelakkvlpgrggfvsf
00461651   1/1  lrk..vrrglggtlsplaaaallaal.....egleerrerlrenadrlaeaLaelpgvervlypglpphg
00448071   1/1  lllllkyeqerrfragtpnplaaaallaalellleeglealrarlaeladylaegLeelglelvgppgrr
00511951   1/1  eliealrklllggglggtlspaaaaaalagle.....tleerrarlrenadrlaeaLaelggvalvgypg
00453921   1/1  lgavlgseeiadal..gpllhggtfggnplacaaalaalelleee...ellerlrelgdyllegleell.
00480741   1/1  dlvlalkylgavlgfftgtpnilgiaalaaalellgeeggleeilerlreladylyeglkelglellgpd
00417041   1/1  lvqelgfnsgtspiaaaaglaal.....egleeilerrreladylaeaLkelpglelvgppglsaphlfp
00489521   1/1  ggpaGlrgGalvgndeliealrklrs..ggggtlsplaaaallaale.....gleerrerlrenadylae
00533351   1/1  vlgSfsKalglpGlrvGalvgpdeellllalliealrklrrpgtgsp..splaqaaaaaaledlelrghw
00412601   1/1  spaaaaaalrgletl.....elrrerlaenaallaeaLeelgpgvevvlypglppegahylalrvlklpg
00460561   1/1  llerlppllvgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeegleairarlralad
00494861   1/1  etgrrsgllaaaalaalg...legleelaarlreladylaegLaelglelvgppganivfvdlpgvdaee
00367801   1/1  glggtlspaaaaallrgletl.....elrreraqenadylaelLeelglvvlvyypglpsgafyllaklp
00507541   1/1  iaelahehgallivDeayagglglgvdpgdl...g..aDivtlslhKtlggpkgggGprlGallvrdela
00408971   1/1  laalllryevlllgynyrlspiqaaallaale.....tlderlerrrenadrlaelLaelpgvelvkppg
00487471   1/1  plaaaallaaletl.....eerlerlrenadllaeaLeelpgvtlvlypglpshpghelakklvpggggl
00421441   1/1  gglekrfeagtpnplaiaallaalellg.eglealraralelaeylregleelpglelvgppgrrlggiv
00523021   1/1  divvfSfsKylggtGdrlGglvvtndkelierlrplrsggtsisyvglvtldllprrfeagtpnvaglig
00370391   1/1  ltggeilyelakkinsavfpglqggplnhviaalavAlkealepefkeyaaqvvknakalaeaLlalgfk
00503901   1/1  appeliealrklrsaltlg..vsplaqaaaaaaledgelrlerleehleelrarlrerrdllaealeelg
00500761   1/1  rkrlggllrqagllaaaalaalge...egleellaranalarrlaegLaalpglelvgppetnivffrlp
00355891   1/1  lrsggtlg..psplaqaaaaaaledlelleehleelrerlrerrdrlaealaelglevvgpggglflwvd
00375691   1/1  ealrklrsp....lgvstlaqaaaaaaledgllehleelrerlaerrdllleaLeelglvsvvgpsgglf
00440831   1/1  tndeeladklrklrfpgegfplgggyrgspiaaaaallal.....elleellerrvenakylaeaLeelg
00416741   1/1  klrsggtfg..psplaqaaaaaaled....eleelrerlrerrdllaeaLeelglevvgpsggfflwldl
00517231   1/1  vvtttthKtlrGprgGliltrkglldllrqkgrlilyelakkinsavfpglqggpllhviaalavalkea
00469651   1/1  klrspg..nssvstlaqaaaaaaledgeflehleelrerlrerrdllleaLaelglevlppeggfflwvd
00428061   1/1  nvivlgSfsKtfglaGlRvGylvapaeliealakvlsqlklliraltsnppalaqaaaaaalsdgellel
00393411   1/1  lrklrsgg..gstpsplaqaalaaaledg.eehleelrerlrerrdllaeaLaelpgvevvgppggfflw
00460871   1/1  sKglggprgGaivtndeelakkarklrfpgegfllgggprqhgiaaaaallala.....eleeylerrhe
00465471   1/1  lvgggqerrfeagtpnvlaiaalaaalellge.gleairarlleladyllegLkelpglellgppgrrgn
00507531   1/1  l..gllvdpgal....gadivvgslhKllgPhglggpgaGalavreellralpgrlvgvtgdadgkralr
00506961   1/1  iealrklrsgltlg..vstlaqaaaaaaledggyeehleelrarlrerrdlllealkellppglevvppe
00490701   1/1  gtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellglegleaiaarhleladylaegLaalpa
00470951   1/1  lllllkfmladqerrf..eagTppvaliaalaaalellleeGleairarhreladalreglealglellg
00451711   1/1  iealakvksqllllirgltlnpptlaqaaaaaaledgalreeweeeleelrarlrerrdllvealaelpl
00513231   1/1  ealrklksalglg..vstlaqaaaaaaledgllglegdeehleelrerlrerrdllaeaLeelglkvlpp
00495241   1/1  hKwlgppGiGalyvrkelldkllpllrggggivlvslfgltaaeqerrfeagtpnvaaiaalaaalellq
00474411   1/1  allldlqekrfepgtppvlaiaallaalelllee.glerrarlaeladalraglealglellpegrsggv
00445951   1/1  Gylvappeliealrklrslg...glgvstlaqaaaaaaledglflehleelrarlrerrdllleaLaelg
00521641   1/1  dllerleplllgggslyldlkllldyllayqergfeagTppvaliyalgaalellleegleairarhrel
00435831   1/1  ehagvvPDiv..tlaKglg.gGlPlgavlgsaeimdalap..llhggtfggnplacaaalaaldvlee..
00460241   1/1  apeeliealrklkgggllraltlsvstlaqaaaaaaledg..leehleelrerlrerrdllaealeelpg
00389521   1/1  pGlRlGylvakppeliealrklrsp....lsvsslaqaaaaaaledggfleehleelrerlrerrdllle
00507681   1/1  lrklrslltlg..vsslaqaaaaaaled.glydehleelrallrerrdllleaLeellppglkvlppegg
00352461   1/1  ltladvvtfslsKgggapgGgvlatgdkelieklrrlrkvlgegffthgglagagplalaaglaelel..
00476701   1/1  gcgallvrdkellrralsvdadylgslddggdgvrdlrdftlegsrrfr.alklwaalralgreglreli
00459091   1/1  egGaivtndkelaeklrllrnhgtsksyhglkyvhlllgynyrlseiqAalglaqlekl..derlerrre
00475811   1/1  rkrlggglr....qagvlaaaalva.ledllellaeaherakrlaegLselggvtlvlpvetnmvfvrlp
00528621   1/1  aaaaaaledg...eehleelrerlrerrdlllealkelgglsvvkpsggfflwldlpellllggddaefl
00462061   1/1  llggplspfq......aalllrgletlplrverhtenalalaellaalplvakvlypglpshpghllakr
00354011   1/1  lglpGlRlGylvappeliealrklksa.tlsvstlaqaaaaaaledgelleehleelrerlrerrdllle
00527311   1/1  vhlllgynyrlseiqAalglaqlekl..derlerrrenaklyaelLkdlpgvklpkypglassvyhlfsi
00445231   1/1  stlaqaaaaaals......dldyleelrerlrerrdllveaLaelglevlppeggfylfldls.ldaeel
00479561   1/1  lgvstlaqaaaaaaledg..eyleelrarlrerrdllaealeelglkvlkpsggfflwldlp.ldaeela
00357001   1/1  ldyktvakngstanTpptlaiyalgaalewlleeggleaiearhaelaallyealdalglvyllvvdpel
00509771   1/1  lpGlRlGylvavgppelieallkllllkslltlgvstlaqaaaaaaledgeehleelrarlrerrdllve
00423831   1/1  eiaelaeeygletglgiwlhvDaAyggfllpfleklrpldfglpgvdsisvsghK..yglaplgcGvvlv
00460891   1/1  klkspltlglvstlaqaaaaaaledg...eeyleelrarlrerrdlllealkellpglkvlppegafflw
00462551   1/1  slaqaaaaaallaygggeehleelrarlrerrdlllealeellpgllvvkpeggfflwldlpelllddae
00456391   1/1  lvapnkdaelakelisalkklkrpltsnpptlaqaaaaaalsdpelreewleeleelrerlkerrdllve
00450681   1/1  nvivlrSfSKtfglaGlRvGylvappevvladaellaalisallklkraltsnpsslaqaaaaaalsdge
00519931   1/1  leplllgggsisfyldlklllkymeayeqekgfeagTppvlliaalgaalellleegleairarhaelae
00405261   1/1  ....lplaydndivlrSfSKyfglaGlrlGwavvpdeelidklrklklpltigvs.slaqlaalaalkdp
00355861   1/1  lgtlaengstynTpptfaiyglglalkllkeegglearikrhaeladllydalealglvllvvdpelrsp
00503401   1/1  dlvtlak.kgstanTppvlaiyalglalewlkeeggleaiekrhaelakllydaldalglvyllgvdpel
00452311   1/1  vappelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwleeleemrerlaerrdllvea


                         -         -         -         -         *         -         -:420
query           PTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE-----------------------------------
00460071   1/1  pavplgegrlRlslglahteedidrllealrevl------------------------------------
00467471   1/1  lerGilvrpigyptvplgpsrlRlslsaahteedi-----------------------------------
00520701   1/1  lleaGilvrpgsapavplgpgrlRislgaatte-------------------------------------
00358461   1/1  kaLkklgflflpsdspivpvilpegafylfakiddf----------------------------------
00401341   1/1  vsvdlpglgidaldlakaLeeagiavrlgshPavp-----------------------------------
00364061   1/1  hivlvdlpgdgidakalakaLeeagiavrpgsfpt-----------------------------------
00459731   1/1  lglevlgpgldshpglvsfrlkgidaeelakaLee-----------------------------------
00461541   1/1  klvsggtdnhlvlvdlrdlgldgkelakaLeea-------------------------------------
00516011   1/1  ileee...dllerlaelgeylregleellaglplv-----------------------------------
00521571   1/1  gdvrglGlmlglelvadkgtnivfvllpdaelaaa-----------------------------------
00501571   1/1  lflfvelpggdaealakalleeGvlvrpgg.....-----------------------------------
00428091   1/1  lgarlregleelaahplvgdvrglglmlgielvdd-----------------------------------
00485711   1/1  pdivtlshKalg..GGav.gseelidalrpl...hgg---------------------------------
00465841   1/1  elpglelvgppggrgpivsfelpggvdaeelakaL-----------------------------------
00497541   1/1  vdaeelaealleeagvlvrpgsafglgplgpgy-------------------------------------
00380341   1/1  qlpggggivsfelkgdgedaeafadaLkea----------------------------------------
00529431   1/1  e...edllerlaelgeylregleellakhplvgdvrg---------------------------------
00502611   1/1  wvdlpdgldaealaealleagilvrpgsaftvgglg----------------------------------
00517571   1/1  nilsfilpvdlgdgidalelaklllelygiavspg-----------------------------------
00473401   1/1  dlkggvdaealadaLeeagiavslgsafslilhpa-----------------------------------
00461651   1/1  gfflwvdlpegrgglvsfrlkdgidaealakale------------------------------------
00448071   1/1  sgllvsfdlpdgvdaeelakaLleeygiavspgsa-----------------------------------
00511951   1/1  lpshpghelakkvlpgrggfvsfdlpgggedaeaf-----------------------------------
00453921   1/1  ..lplvgdvrglGlmlgielvsddgllalalaall-----------------------------------
00480741   1/1  grgrggivsfrlpdgidaaakalakalleagiavspg---------------------------------
00417041   1/1  vllplpeltelllplgglllwlfllegidreelak-----------------------------------
00489521   1/1  aLaelggvelvlppglpshpghylavrlprglg-------------------------------------
00533351   1/1  laeleelrerlrerrdllleaLkel.lpllgvsv------------------------------------
00412601   1/1  aggivsfelkg..daealaalldelgiavrpgslg-----------------------------------
00460561   1/1  ylaegLaalpglellgperrggivsfrlp.gvdae-----------------------------------
00494861   1/1  laaalleagiavspg.......gpgalRls----------------------------------------
00367801   1/1  akgrggllsfelkg..daeavaklldelgvavrpg-----------------------------------
00507541   1/1  ealplrlggggergfvltldreqairr.glagtgn-----------------------------------
00408971   1/1  lsshafylfailvlllglgldrdelaeaLeeagia-----------------------------------
00487471   1/1  lsvelkdgedaeelldalkeagiavslgsafslillp---------------------------------
00421441   1/1  sfelp.gvdaedl..lllergiavspgsacslgll-----------------------------------
00523021   1/1  lgaalsplqaalllrgl.....etldlrler---------------------------------------
00370391   1/1  lvsggtdnhlvl----------------------------------------------------------
00503901   1/1  lkvvppeggfflwvdlpelllkalalllllggl-------------------------------------
00500761   1/1  g.....ellerllergiavspg.....sag----------------------------------------
00355891   1/1  lpdlgldaeelaealleagvlvrpgsafg...g-------------------------------------
00375691   1/1  lwvdlp.daeelaealleegvavrpgsafgv..gp-----------------------------------
00440831   1/1  vpvvgpvgghgvfldlellldgitgdelaeallea-----------------------------------
00416741   1/1  pgldaeelaealleagvlvrpgsafg...gpgllRl----------------------------------
00517231   1/1  lepefkeyakqvvenakalaeaLlelgfdlvsgg------------------------------------
00469651   1/1  lpelgldaeelaerlleeagvlvrpgsafg.plgp-----------------------------------
00428061   1/1  wleeleelrerlaerrdllveaL-----------------------------------------------
00393411   1/1  vdlpglgldaeelaeaLleeagvavrpgsafg.-------------------------------------
00460871   1/1  narylaeaLkelgipvvgptgghlvfvdlrkll-------------------------------------
00465471   1/1  ivsfrlp.gvdaedlakallekgiavrpgsacasg-----------------------------------
00507531   1/1  lalqtreqhirrekgtsnictpnglaaaaalaa-------------------------------------
00506961   1/1  ggfflwldlpegldaeelaealleegvlvrpgs-------------------------------------
00490701   1/1  vpglellgppdaarrgglvsfrlpg...aeala-------------------------------------
00470951   1/1  pdpaarspgvvsfrlpegvdaeellaallerygia-----------------------------------
00451711   1/1  pgglevvvpqggmflwldlpd...e.fv------------------------------------------
00513231   1/1  eggfylwvdlpelllalkllkglggldalelaerl-----------------------------------
00495241   1/1  eegleairerhreladyllegLkelpgvll----------------------------------------
00474411   1/1  vsfrlpdgidaaalakaleeagiavspgsafla-------------------------------------
00445951   1/1  lrvlkpeggfflwldlp...daelarllleagv-------------------------------------
00521641   1/1  adalreglealglellgpdpelrspgvvsfrlpeg-----------------------------------
00435831   1/1  .egllerlaalgeylrdgllellakhplvg----------------------------------------
00460241   1/1  levvppeggfflwvdlpelllktgldaeelaer-------------------------------------
00389521   1/1  aLeepglevlppegglflwvdlpalllkldgld-------------------------------------
00507681   1/1  fflwldlpdgldaeelaealleegvlvvpgsafgl-----------------------------------
00352461   1/1  .edllarvienanylaeaLeel.gvpvvtpvgg-------------------------------------
00476701   1/1  erlielarylaegLrelpgfellgepelglvvfrl-----------------------------------
00459091   1/1  naklyaelLkklpgvelpkppglashsayylfpillk---------------------------------
00475811   1/1  gaaidalellellleegvll.......vplgpglv-----------------------------------
00528621   1/1  arllleagvlvrpgsafgllgspgpgylRlsfa-------------------------------------
00462061   1/1  qlkglggllsfelkggleaakafldalklfv---------------------------------------
00354011   1/1  aLeelglevlppegglflwvdlpelllklggldae-----------------------------------
00527311   1/1  llkdgleasrdeliealkekgiltrvgyiplhlqpay---------------------------------
00445231   1/1  aerlleegvlvrpg........pgylRisl----------------------------------------
00479561   1/1  erlleegvlvrpgsafg.llgegylRlslg...-------------------------------------
00357001   1/1  rsgmvvsftlpdgvlakaflkllkeegiavlkGhrcv---------------------------------
00509771   1/1  aleelpglevlkpsggfflwldlpelgledaeelaea---------------------------------
00423831   1/1  rdkellrealsvnadylggdlgsftlegsrpgarala---------------------------------
00460891   1/1  ldlpelgldseelaerlleeagvlvvpgsafgl-------------------------------------
00462551   1/1  fllrllleagvavvpgsafglg.gegylRlsfa-------------------------------------
00456391   1/1  aLkklptpggldvikpqggffl------------------------------------------------
00450681   1/1  llaewleeleemrerlkerrdllveaLrelg---------------------------------------
00519931   1/1  alraglealglellgpladpelrsptvtavkgp-------------------------------------
00405261   1/1  ldaylllrgesletlelrrerlrerrella----------------------------------------
00355861   1/1  mvvtfrlpdgvdakkflkllkeagi...avlgGhr-----------------------------------
00503401   1/1  rsptvvtfnlpdgvdakdflklldeagi...avlkGh---------------------------------
00452311   1/1  Lkelggpgdldvilpqggfflfldlpd...e---------------------------------------