[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68197.1


[Show Plain Result]

## Summary of Sequence Search
   1::179
   3::175  8.3e-45 28.9% 0049338 00493381 1/1   CoA N-acyltransferases (Nat)            
   1::175  1.6e-40 26.4% 0052652 00526521 1/1   CoA N-acyltransferases (Nat)            
   2::177  6.5e-28 20.5% 0048433 00484331 1/1   CoA N-acyltransferases (Nat)            
  11::177    2e-27 25.0% 0052701 00527011 1/1   CoA N-acyltransferases (Nat)            
   1::177  4.1e-27 22.6% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
   4::168    1e-25 22.2% 0052754 00527541 1/1   CoA N-acyltransferases (Nat)            
  11::178  9.4e-25 22.6% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
  10::178  6.5e-24 20.5% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
  10::176  1.2e-23 23.1% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
  13::177  1.6e-23 20.9% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
   1::176  2.1e-22 21.0% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
  10::179  4.2e-22 20.4% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
   7::176  3.2e-21 21.5% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
  11::181  3.6e-21 23.2% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
   9::173  4.4e-21 24.1% 0052713 00527131 1/1   CoA N-acyltransferases (Nat)            
  11::176  2.9e-20 22.1% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
   6::158  6.2e-20 22.9% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
   9::174  6.6e-20 20.8% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
  10::180  4.2e-19 21.4% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
   9::180  4.5e-19 22.4% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
   8::171    9e-19 26.7% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
  11::168  1.6e-18 22.1% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
  11::177  1.9e-18 24.2% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
   6::175    2e-18 23.0% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
  10::172  9.5e-18 23.1% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
   9::177  3.3e-17 21.5% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
  10::164  4.2e-17 21.6% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
  10::175  8.3e-17 21.7% 0049031 00490311 1/1   CoA N-acyltransferases (Nat)            
  11::159  1.2e-16 21.3% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
  11::176  2.2e-16 21.9% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
  11::161    3e-16 22.0% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
  11::168  3.5e-16 23.8% 0052522 00525221 1/1   CoA N-acyltransferases (Nat)            
  11::177  7.9e-16 21.8% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
   9::178  8.6e-16 20.1% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
   9::173  2.2e-15 20.8% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
  33::179  3.3e-15 23.4% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
   1::158  1.2e-14 24.7% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
   4::175  1.2e-14 20.1% 0051326 00513261 1/1   CoA N-acyltransferases (Nat)            
   9::158  4.7e-14 23.7% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
  12::149  4.9e-14 21.3% 0045986 00459861 1/1   CoA N-acyltransferases (Nat)            
   1::174  5.5e-14 20.5% 0045896 00458961 1/1   CoA N-acyltransferases (Nat)            
  10::175  2.6e-13 20.0% 0051915 00519151 1/1   CoA N-acyltransferases (Nat)            
  13::175  1.6e-12 19.4% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
   9::171    8e-12 17.8% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
   1::165  7.4e-10 23.2% 0043712 00437121 1/1   CoA N-acyltransferases (Nat)            
   8::175  1.3e-09 21.3% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
  11::164  1.3e-09 22.0% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
  11::174  3.3e-09 21.7% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
   8::176  4.5e-09 19.1% 0052704 00527041 1/1   CoA N-acyltransferases (Nat)            
  57::165  1.4e-08 21.8% 0043128 00431281 1/1   CoA N-acyltransferases (Nat)            
   8::175  9.3e-08 20.9% 0051252 00512521 1/1   CoA N-acyltransferases (Nat)            
  10::167  1.1e-06 21.3% 0051830 00518301 1/1   CoA N-acyltransferases (Nat)            
  13::125  1.2e-05 20.0% 0051777 00517771 1/1   CoA N-acyltransferases (Nat)            
   1::155  0.00025 18.5% 0048084 00480841 1/1   CoA N-acyltransferases (Nat)            
   1::179


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
00493381   1/1  --pptleterliLrpltleDaeallellndpealvarylpwlpsplsleearaflerllalyadggalvf
00526521   1/1  mlpmptleterliLrpltleDaeallell.sdpevlrylplrvppplsleeareflerllalyasggalv
00484331   1/1  -gmpptleterltlRpatpeDaeallallreadpevarllpflgpplsleelraflerllaaealdpggl
00527011   1/1  ----------ltlrpltpedaeallallndafv..alyllgpppplsleelrerleedl.....gggllf
00513771   1/1  M.pptleterltlRpatpeDleallallaeapevlryl.....pplseeellerlrellad...pgslfl
00527541   1/1  ---plptleterltlRpatpeDleallallndaeve......llggplspedleeflerllerladpgal
00501851   1/1  ----------rltirpatpeDleallalladafaeelylgfpep...lsleelralleel.....lpggl
00528741   1/1  ---------erltirpatpeDleallallndaf..veeylpalpeplsleelrayler....ladpgslf
00513751   1/1  ---------dltirpatpeDleallalladafve..eylllfppplsleelralleella....pgslll
00514211   1/1  ------------tiRpatpeDleallallndafveey..llpfppplsleeleerlrellad...gdg.l
00469881   1/1  m..........tiRpatpeDlpelldallallrda..faellalllpeplseeeleellerlledladpg
00496411   1/1  ---------rltiRpatpeDleallalladafveeyalllpappldaellaerslerlrelladggalll
00517511   1/1  ------mtmditirpatpeDleallallneafaelylfllspesleallerll...........pgalfl
00523471   1/1  ----------ltiRpatpeDlpallalladafpevyafllgtppldalaeeeslerleelladgdalelf
00527131   1/1  --------erltirpatpeDleallellneafveef.......lplsleelrefled.......pgalll
00481741   1/1  ----------yltirpatpeDleallallreafve.............ppesledleelladppal...l
00486741   1/1  -----mmeiirpltpadldallellaaagpadglavvellvllellgplldrgtlfvalddgelvGfial
00498041   1/1  --------me..iRpatpeDlpallallneafpevaaflgsppl...splseeelrellaadladgplgl
00532921   1/1  ---------rltirpatpeDleallallndafveeya...glppplsleelrellae.....adpgalfl
00461771   1/1  --------kmiemrltirpatpeDleallellreafaef....ypelpplsleelrelladp.......g
00507331   1/1  -------tmrltirpatpeDleallallreafaellallglp..plseeeseeflrellad...pgalll
00526641   1/1  ----------ltirpatpeDleallallaeafaelylglppplsleellallaell........pgglfl
00513031   1/1  ----------mltirpatpeDleallallreafavlgaelppp....sleellerl......lddpgllf
00461581   1/1  -----pttmritirpatpeDleallallreafve.....lpldpplsledlrelledp.......galll
00514371   1/1  ---------Meirirpa...dledllallreafveefallppp...lsledlrelled.......pgalf
00514931   1/1  --------glmslmtmditirpatpeDleallellre.......vfpeelpplsleelrellad......
00498841   1/1  ---------rltirpatpeDleallallndafvelylglllllafelaplsleellerlrelladgga..
00490311   1/1  ---------erltirpatpeDleallallneafeallgllppptleellerlle.........adpggll
00514921   1/1  ----------HltirpatpeDleallallndafveeylllppplteeeslerlrelladp.......gsl
00490321   1/1  ----------mtirpatpeDleallallneafv....ellgelpplsleellell......lddpgalfl
00502231   1/1  ----------mitirpa.peDlpallallreafvellallllaplseelslerlrellad.......pgg
00525221   1/1  ----------ltIrpatpeDleallellrelfaelglllpepe...slelllellad.......pgalll
00512481   1/1  ----------itirpatpeDleallallrea.........f....lseeelrall.........pgglll
00530761   1/1  --------mdltirpatpeDlpailallaeafaeelalllpeeplsleelaall.........apgalll
00509401   1/1  --------mmdmsditirpatpeDleallallrea........fpeeeplsledlralled.......pg
00514201   1/1  --------------------------------Pedleallallrelfeaplseeeseelleelledg...
00472801   1/1  m......terltirpatpeDlpallallreafve..eellpdleplsleelralleallalllldpgalf
00513261   1/1  ---ltltvlvlhplrppkpapgsvvysrpipllggrlslRpltleDlelllewl..ndphvaawwglp..
00493111   1/1  --------mrltirpatpeDleallallaeafpel.......geplsleelrellad.......pgalll
00459861   1/1  -----------gtirpatlspeDleallallneafveefgllppldeeeslellrellad.......pga
00458961   1/1  M..........tirpatpeDpllleallallrea............fpeelpeeseellrellad..pel
00519151   1/1  ---------ditirpatpeDleallellrelfletylfllepltleellellee........llpgalvl
00520401   1/1  ------------IR.atpedleallellreafpeeylllllelllell................pgalfl
00528581   1/1  --------mmnitirpatpeDleailellreafrdtyafllspevlealgfdeglplseaeslerlrell
00437121   1/1  M.........ltiRpatpeDlpallellvdafpetyatvltldnlrrwlfkisvlkiliddlisillpgl
00528291   1/1  -------mmditirpatpedleallallaeafaeelallll.......................pgalll
00512321   1/1  ----------itirpatpedleallelllev........fpepy..seelledlld........psalvl
00488761   1/1  ----------Miiirpatpedleailallrevf........peelplsleelrdlld........pgall
00527041   1/1  -------pmditirpatpeDlpallallraafretyalllsaeqlealldeaeslerlrell.....pga
00431281   1/1  --------------------------------------------------------ellelldlpgslff
00512521   1/1  -------mmditirpatpedleallelllel.........fpeeysleelle...........lpgalll
00518301   1/1  ---------mitirpatpedleallellreafleel........plseeelrerla.......dga.lll
00517771   1/1  ------------IRpatpeDleailelilelfeeealllpellalpldeeellelleellenpn..slll
00480841   1/1  plpmmllmmditirpatpedldallallaaaf.....pepfs......eafaeelldg.........lvl


                         -         -         *         -         -         -         -:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
00493381   1/1  vieddgelvGfiglrridpengtaeigywvdpsyrGkGiatealkalldyafeelglrrieatvladNea
00526521   1/1  faiedkedgeliGfiglrridpengtaeigywlapeyqgkGyatealkalldyafeelglhrieatvdpd
00484331   1/1  flvaeddgelvGfaglrpiddeggvaeiglavapeyrGkGiGtellralleyafrelglrrlvlevladN
00527011   1/1  vaeddgelvGfvgl.rpdpdggvaeigylavlpdyrgkGigtellralleyarel.glkrlvatvdpdNt
00513771   1/1  vaeddgelvGfaglrpidagegvaeigylavdpeyrGkGiGtallealleyafrelglrrlvlevdadNe
00527541   1/1  llvaedkedgelvGfvglrpid.eggvaeiglavapeyrGkGigtellealleyafellglrrlvlevla
00501851   1/1  flvaededgelvGfaglrpiddgpagggvaeiglavdpeyrgkGigtallealleyare.lglrrlvlev
00528741   1/1  lvaeddgelvGfaglrpiddeplggvaeiglavdpeyrgkGiGtallealleyarel.glkrivlevdpd
00513751   1/1  vaeddgelvGfaglrpiddepgggvaeigglavdpeyrgkGigtallealleyarelg.lrrlvlevdpd
00514211   1/1  lvaeddtgelvGfaglrpiddgplglgvaeiglavdpeyrgkGiGtaLlealleyare.lglrrlvlevd
00469881   1/1  alflvaeddgelvGfaglrpdddepggpvaeigylavdpeyrgkGiGraLlealleyarel.glkrivle
00496411   1/1  vaeddgelvGfaglrpldsllalpgggvaeigylavdpeyrgkGiGraLlealleyare.lglrrlvlev
00517511   1/1  vaeddgelvGfallspidslpgggtaeieglaVdpeyrgkGiGsaLleallelare.lglkrlylevlad
00523471   1/1  lvaeddggelvGfaglrpiddgpggklvaeigglavdpeyrGkGiGtaLlealleyarer.glrrlvlev
00527131   1/1  vaeddgelvGfaglslidp..gtaeigrlavdpeyrgkGiGkallealleyakerlglkrlylevledNe
00481741   1/1  lvaeddgelvGfaglrplddegrvaeigylavdpeyrgkGiGraLlealleyarelg.lrrlvlevlpdN
00486741   1/1  ipygepfafigllivhpdyrgrGigralleaalerlpgrplvllpeanpallalleklgfrlarellrmq
00498041   1/1  flvaeddgeivGfaglrpddsglagdllgllllglllllglllllllllpgggvaeigrlaVdpeyrGkG
00532921   1/1  vaedakedgepgepelvGfaglrpidspggggvaeigylavdpeyrgkGiGraLlealleyarel.glkr
00461771   1/1  alflvaeddgelvGfarlrpdgde.rvaeigrlaVdpeyrgkGiGraLleallelarer.glkrlvlev.
00507331   1/1  vaeddgelvGfaglrpdddetgggrpvaeigylavdpeyrgkGiGraLlealleyarelg..rrlvlevl
00526641   1/1  vaeddgelvGfaglrpldslllgggvaeigglavdpeyrgkGiGraLlealleyarer.glrrlvlevlp
00513031   1/1  lvaeddgelvGfarlrpdgdep.vaeigrlaVdpeyrgkGiGraLlealleyareelglrrlvlev..dn
00461581   1/1  vaeddgelvGfarlrpldsllllllllllllpggdvaeigrlavdpeyrgkGiGraLleallelarerlg
00514371   1/1  lvaeddgelvGfaalrpld..ggvaeigrlavdpeyrgkGiGraLleallelarer.glrrlvlevlvlp
00514931   1/1  .pgalflvaeddgelvGfarlrplpdg..gvaeigrlaVdpeyrgkGiGraLleallelarel.glkrlv
00498841   1/1  .lllvaeddgeplvGfaglrpidsegggvaeigglavdpeyrgkGiGraLlealleyare.lglkrivle
00490311   1/1  lvaedkedgelvGfaglrpidslllgggvaeigylavdpeyrgkGiGraLlealleyarel.glkrlvle
00514921   1/1  llvaeddgelvGfaglrpldslllpgggvaeigglavdpeyrgkGiGraLlealleyarel.glrrlvle
00490321   1/1  vaeddgelvGfarlrpl.pggdvaeigrlavdpeyrgkGiGraLlealleearelg.lkrlvlev...ne
00502231   1/1  lllvaedddGelvGfaglrpdddlplgggvaeigdlavdpeyrgkGiGraLleallelarel.glrrlvl
00525221   1/1  vavdeedgelvGfaalslldstlagrdvaeiedlyVapeyrgqGiGkaLleallelarer.gakrlrlev
00512481   1/1  vaeddgeivGfaallpld..pdvaeigrlaVapeyrgkGiGkaLleallelarel.glkrlvlevladnt
00530761   1/1  vaeddgelvGfalllplds.gdvaelgdlaVapearGrGiGraLlealeelarerlgarrlrlevledNa
00509401   1/1  alflvaeddgelvGfarlrpdddlpdvaeigrlaVdpeyrgkGiGraLleallelarerlglrrlvlev.
00514201   1/1  ..lflvaeddgelvGfaglrpdd..ggvaeigrlavdpeyrgkGiGraLlealleyarelg.lrrlvlev
00472801   1/1  lvaedeedgelvGfaglrplpdpvlglggvaeigdlavdpeyrgkGiGraLleallelarel.glrrlvl
00513261   1/1  .lsleevreyledllad...phslpliaeldgepvGyvelywvke....delgyyydaepgdrgihllig
00493111   1/1  vaeddgelvGfaglslldslllgldgggvaeieglyVlpeyrgrGiGraLlaallewarer.Garrlvle
00459861   1/1  lllvaeddgelvGfaglrplddlplgldvaeigdlavdpeyrgkGiGraLleallelarel.glkrlvle
00458961   1/1  .flvaeddgelvGfarlrpl.pggdvaeigrlaVdpeyRGkGiGraLlealleearer.glkriylevle
00519151   1/1  vaedleelldkedgeivGfallrldystpggkvayiedlyVlpeyrgkGiGkaLlealeelaker.gckr
00520401   1/1  vaeddgelvGfarlrpldsllllgggvaeigrlavdpeyrgkGiGraLleallelarel.glkrlvlev.
00528581   1/1  ed...pgglflvaeddgkivGfialspdgvlllglllllsllpggkvaeigrlaVdpeyrGkGiGsaLle
00437121   1/1  lllllsgdfrllgtfvaltrdidhytnfylilsedlakleellkaldlidwsqgllisslnlrlievike
00528291   1/1  vaeddgeivGfalllplgg...vayieslaVdpeyrgqGiGraLleaaeeearer.glkrlylevd..np
00512321   1/1  vaeddgelvGfarlipdg..gdvaeigdlaVlpeyrgkGiGsaLlealleyakel.glkriylevladn.
00488761   1/1  lvaeddgelvGfarllp...ggdvaeigrlaVdpeyrgkGiGraLleallelarel.glkrlvlev...n
00527041   1/1  lvlvaeddgeivGfaal......ggvaeierlyVhpdyrgrGiGraLlealeelarer.garrltlev..
00431281   1/1  vaeddgeivGfarlrpldd..dvaeieslaVdpeyrgqGiGkkLlealleyarelglkrill......np
00512521   1/1  vaeddgeivGfallrplg...dvaeierlaVdpeyrgkGiGsaLlealeelaker.gcrrlllevl..ne
00518301   1/1  vaeddgelvGfarlvpdgd..dvayigdlaVlpeyrgqGiGkaLleaalelakel.gakriylev...ne
00517771   1/1  vaeddgeivGfillylefs.gdvaeiellyVdpeyRgqGigtaLlealeewakel---------------
00480841   1/1  vaeddgrvvGfaallplrlliggrggrvgyiegvaVhpdyRGqGlGsaLldaaeeeare..garrlvLev


                         +         -         -         -         -         *         -:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD-------------------------------
00493381   1/1  SirlyeklGFvleGtlrdyllingryrDtvlysll-----------------------------------
00526521   1/1  NlaSirvyeklGFrlegtlrdyllingrwrdtvly-----------------------------------
00484331   1/1  eaairlyeklGFeeegelrdyylidgrlrdavlmsll---------------------------------
00527011   1/1  asirlyeklGFelvgelr..lpingewldlvlmekll---------------------------------
00513771   1/1  aairlyeklGFeevgelrdyyllpdgrlrdavlmsll---------------------------------
00527541   1/1  dNeaairlyeklGFelegelrdyyligg------------------------------------------
00501851   1/1  dpdNeaairlyeklGFelvgelrdyyliggrlvdavlm--------------------------------
00528741   1/1  NeaairlyeklGFeevgelrdyyldggrlvdavlmskl--------------------------------
00513751   1/1  NeaairlyeklGFelvgelrdyyliggrlvdavlme----------------------------------
00514211   1/1  pdNeaairlyeklGFeevgelrdyylidgelrdavlm---------------------------------
00469881   1/1  vladNe.airlYeklGFeevgelpdyyllpdgeyvd----------------------------------
00496411   1/1  dpdNeaairfYeklGFeevgelr..lyydgegldavlme-------------------------------
00517511   1/1  NeaairfYeklGFvevgelrdyyliggeyedavlme----------------------------------
00523471   1/1  dpdNeaairlYeklGFeevgelr..lyldgrkldevlmekd-----------------------------
00527131   1/1  aairlYeklGFvevgelrd....ygeyvdallm-------------------------------------
00481741   1/1  eaairlyeklGFevvgelrdyylllllllldgeged----------------------------------
00486741   1/1  ldlpplpppleterltiR----------------------------------------------------
00498041   1/1  iGraLlealleyarer.glrrlvlevladNeaai------------------------------------
00532921   1/1  ivlevlpdNeaairlYeklGFeevgelrdyyl........------------------------------
00461771   1/1  .dne.airfYeklGFevvgelpdyyllgylgdgedavlmv------------------------------
00507331   1/1  adNeaairlYeklGFevvge.......lgdy---------------------------------------
00526641   1/1  dNeaairlYeklGFevvgelrlyyldgg------------------------------------------
00513031   1/1  e.airfYeklGFeevgelpdyyllgylgdyedailmv---------------------------------
00461581   1/1  lrrlvlev...neaairfYeklGFevvgelr..yy-----------------------------------
00514371   1/1  dNeaairlyeklGFevvgelplyygipgeylm--------------------------------------
00514931   1/1  lev..dne.airfYeklGFevvgelplyyllgllgdg---------------------------------
00498841   1/1  vlpdNeaairlyeklGFeevgelr----------------------------------------------
00490311   1/1  vlpdNeaairlYeklGFe.............dpkg-----------------------------------
00514921   1/1  vlpdNeaairlyeklGFea---------------------------------------------------
00490321   1/1  aairfYeklGFeevgelplyygighigmyedallmv----------------------------------
00502231   1/1  evlpdN.aairlYeklGFevv-------------------------------------------------
00525221   1/1  ladNeaAirlYeklGFeevgelknyyld------------------------------------------
00512481   1/1  aaialYeklGFevvgeledyygdgedalvmekdlrll---------------------------------
00530761   1/1  aaialYeklGFepvgelpdyyl.dgrledavlmeklld--------------------------------
00509401   1/1  ..npaairfYeklGFevvg...evyledgidav-------------------------------------
00514201   1/1  ladNeaairfYeklGFevvgelpdy.yldg.idallmek-------------------------------
00472801   1/1  ev...neaairfYeklGF----------------------------------------------------
00513261   1/1  dpdyrgkGlgtallraliaylflddpgarrivlep-----------------------------------
00493111   1/1  vlpdNtaairlYeklGFe----------------------------------------------------
00459861   1/1  vladNeaai-------------------------------------------------------------
00458961   1/1  dNeaadeslirfYekl.Feevgelpdydgidgvf------------------------------------
00519151   1/1  lylevledNepairfYeklGFevvgelkgyyldgg-----------------------------------
00520401   1/1  ..npaairfYeklGFevvgelplyy...dgedavl-----------------------------------
00528581   1/1  aalerakel.Glkriylevde.NeaairfYe---------------------------------------
00437121   1/1  laaskglkvellratlllvlprela---------------------------------------------
00528291   1/1  aairlYeklGFevvgelplyg...ggldallmekr-----------------------------------
00512321   1/1  paiklYeklGFvpvgelklyygig----------------------------------------------
00488761   1/1  eaairfYeklGFevvgelp..lyydg.idallmv------------------------------------
00527041   1/1  .neaairfYeklGFvvvgele..lyyggegldlvlm----------------------------------
00431281   1/1  aaikfyeklGFevvgelklyyging---------------------------------------------
00512521   1/1  aairfYeklGFeevgeiedyy...dgedallmeke-----------------------------------
00518301   1/1  aaiafYeklGFevvgelelyyggpgvl-------------------------------------------
00517771   1/1  ----------------------------------------------------------------------
00480841   1/1  ...naaarrfYerlG-------------------------------------------------------