[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68332.1


[Show Plain Result]

## Summary of Sequence Search
   1::429
   1::415  2.2e-73 31.9% 0042501 00425011 1/1   eneral substrate transporter            
   7::424  8.9e-60 26.3% 0042480 00424801 1/1   eneral substrate transporter            
   1::429


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSITLLDGVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQIDTGLSNEAYALGAGIFFVVYAFLGVP
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff
00424801   1/1  ------Mk..ekrr.rvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllgaalgsp


                         -         -         *         -         -         -         -:140
query           ANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSEAKFLIIRTLLGAAEAGFFPGMIYLTSQWFPQRNRAS
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala
00424801   1/1  laGrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalaliaelfpp


                         +         -         -         -         -         *         -:210
query           IMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAIGAGIFTFFWLDDTPQQARFLSLE
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleld.....lgWrwafliaailalllalllllll
00424801   1/1  eerglaleygllsaggslGallgpllggllld.lg......wrlvfliaailalllllllllflpesprf


                         -         -         -         +         -         -         -:280
query           EKNALIRQLASEEEKKVTSRLADALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVV
00425011   1/1  pesprflllkglseeerkvlerrlkadaeakaasplsllellrnprflllllayfllflgfyglltflpl
00424801   1/1  laakgklee.........ekkaslklslkellknprllllllavfllflgfyalltylplylqslfevlg


                         -         *         -         -         -         -         +:350
query           TAVPWVAALLGTWLIPRYSDRTGDRRNVAAVTLLAAGIGIGLSGLVSPVLAILALCVAAVGFIAVQPVFW
00425011   1/1  ylqevlglsas.qaglllalfglggilgsllagrlsdrlpegrrrrllliglllaalgllllallpgtsl
00424801   1/1  lsasq.aglllalfglggilgsllagrlsdrl.grrrllligllllalgllllalapslwllllllillg


                         -         -         -         -         *         -         -:420
query           TMPTQLLSGTALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLSGVAIIGSLIIFTLSVNRP
00425011   1/1  allllllfllgfglggafpllfalvaelfppelrgtasgllnlagnlggallgpllagllldatg-----
00424801   1/1  fgfglafpllfallselfppelrgtalgllnllagslggalgpllagllldalg..ysaaflllaalall


                         -         -         +         -         -         -         -:490
query           VAQSGAAHH-------------------------------------------------------------
00425011   1/1  ----------------------------------------------------------------------
00424801   1/1  alll------------------------------------------------------------------