[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68340.1


[Show Plain Result]

## Summary of Sequence Search
   1::172
  31::172  9.3e-38 48.6% 0048741 00487411 1/1   rial adhesins                           
  33::172  3.1e-33 45.7% 0048260 00482601 1/1   rial adhesins                           
  34::172  3.2e-32 51.2% 0049046 00490461 1/1   rial adhesins                           
   1::172


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
00487411   1/1  ------------------------------vvdstCsvdtgsanqtVdlgtvstsdlaavgstsgpvpft
00482601   1/1  --------------------------------pptCtvnn....itVdlgdvsisdls..ggtsgekpfs
00490461   1/1  ---------------------------------stCtvstg..nltVdLgtvs...........gatpft


                         -         -         *         -         -         -         -:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
00487411   1/1  ikLtnCdagvllkkvtvtftgtadganpgllalt..sggatgvgiqlldadgtplklggassvlglvvll
00482601   1/1  itlkccd.gassvkltftgtatstnggllalt.sstsasgvgiqlldnndsslgtpitlgsstsvlllvl
00490461   1/1  ikl.nCpggv.kvkvtfsgttddannglllllagsgtAsgvgiqlld.dgtpiplgtalalvtltsg..s


                         +         -         -         -         -         *         -:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE--------------------------------------
00487411   1/1  tdg..satlnftAryvatggalasgtvtaGdf--------------------------------------
00482601   1/1  llsngsatlpfaArlkktgatvtaGdfnAtat--------------------------------------
00490461   1/1  atlpltAryvatggtvtaGsvnatatftltYq--------------------------------------