[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68451.1


[Show Plain Result]

## Summary of Sequence Search
   1::368
   4::244  5.9e-61 41.9% 0052117 00521171 1/1   ne nucleotide alpha hydrolases-like     
   3::298    1e-58 36.4% 0046213 00462131 1/1   ne nucleotide alpha hydrolases-like     
   1::195    2e-49 40.2% 0039977 00399771 1/1   ne nucleotide alpha hydrolases-like     
   4::269  7.3e-47 36.4% 0051038 00510381 1/1   ne nucleotide alpha hydrolases-like     
   6::195  2.5e-46 42.2% 0047035 00470351 1/1   ne nucleotide alpha hydrolases-like     
   5::187  1.1e-43 40.8% 0050233 00502331 1/1   ne nucleotide alpha hydrolases-like     
   3::248  2.6e-37 25.2% 0048858 00488581 1/1   ne nucleotide alpha hydrolases-like     
   1::218  1.9e-36 33.3% 0050746 00507461 1/1   ne nucleotide alpha hydrolases-like     
   6::187  2.6e-32 34.2% 0047848 00478481 1/1   ne nucleotide alpha hydrolases-like     
   1::201  1.4e-30 37.2% 0049476 00494761 1/1   ne nucleotide alpha hydrolases-like     
   4::249  3.7e-30 26.4% 0045391 00453911 1/1   ne nucleotide alpha hydrolases-like     
   1::225  8.1e-27 28.3% 0048369 00483691 1/1   ne nucleotide alpha hydrolases-like     
   3::187  2.6e-19 29.5% 0050128 00501281 1/1   ne nucleotide alpha hydrolases-like     
   3::193  4.1e-15 27.6% 0052363 00523631 1/1   ne nucleotide alpha hydrolases-like     
   6::128  1.9e-12 33.0% 0043381 00433811 1/1   ne nucleotide alpha hydrolases-like     
   6::187  3.2e-10 29.7% 0050739 00507391 1/1   ne nucleotide alpha hydrolases-like     
   4::128  1.3e-09 24.8% 0039538 00395381 1/1   ne nucleotide alpha hydrolases-like     
   7::128  6.2e-06 25.2% 0051645 00516451 1/1   ne nucleotide alpha hydrolases-like     
   1::368


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSESPKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
00521171   1/1  ---lgggkkvvvllSGGvDSsvaaallkkagyeviavhfdyglrtde..lcvseeeledakklaeklgip
00462131   1/1  --rrywdlpfvpdleellealvellrdavrkrlvgdkkvvvalSGGlDSsvlaallkeaggaegllfmkn
00399771   1/1  iavlrrlmsgkkvvvalSGGlDSsvllallkelgyeviavtvdlg........qrhsedleaarevaekl
00510381   1/1  ---idleelieelvellrdyvlkrggkkvvvalSGGvDSsvllallakalglevlavtvdtg........
00470351   1/1  -----eellerlveairdylllvgdkkvvvglSGGvDSsvlaallkkalgyevlavtvdtgl.......l
00502331   1/1  ----kkkvvvalSGGlDSsvalallkeagyeviavtvdlgqre..........dleaarevakklgivpl
00488581   1/1  --rrYwdlpfldleeavealrellrdavrkrlvsdvpvgvlLSGGlDSslvaalaaralgnvlaftvgfg
00507461   1/1  ekllkkllkkvekaikdykllvggdkvlvalSGGvDSsvllallkkllkrlpgyelvavhv......dhg
00478481   1/1  -----kkvvvalSGGlDSsvllallkealgyeviavtvdygqre..........eleaarelakklgikp
00494761   1/1  skltldallllpalllalcleklnelledlvaeeilrealeefgdkvvvalSGGkDSsvllhlllkagle
00453911   1/1  ---vlknpildillvkldfdleeiiealveflrdyllksgakkvvlglSGGvDStvaaalakkalgrlpl
00483691   1/1  eeaiklfrllkkgdkvlvalSGGkDStvllhlllelarrllgfevvavhv......dhglrgesdeelef
00501281   1/1  --gtsgkvlvllSGGiDSpvaayllmkrGvevialhfdlgpltl.eealevvklllkll...........
00523631   1/1  --lklmkvvvlfSGGkDStlalylalelghevvalltllpeeldsymfhtvnlelaklqAea..lglpli
00433811   1/1  -----lkkkvvvlySGGkDSslaLywllkkgyeVvalltlvgseldsymfhtvnlelaelqaealglply
00507391   1/1  -----kgvvlGlSGGvDSalaaalavralgllrlergllnlnvlavtmps........glssd.sledak
00395381   1/1  ---fvldiaglsedeavealrelledavrrrlrgdvpvgvaLSGGvDSslvaalaaralgdvltftigfe
00516451   1/1  ------rvvvsfSgGkDStvllhlalkalrpaglpipvvfl.....dtgyl...fpetyefvdelaerlg


                         -         -         *         -         -         -         -:140
query           TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
00521171   1/1  livvdld........eifleilkkgetpnpcvlcrr.irlrillelaeel.gadviatGhna........
00462131   1/1  wdlddevlavtvdygq...sdeledarevaeklGiphhvvdide...eevldalkdvidagetpnpcvlc
00399771   1/1  gikehhvvdvdlefvedvvltlideykagatpegdypltcalarnliflllae.laeelgadviatGht.
00510381   1/1  lrseeeledarelaeklgiplhvvdid.....elfdalldllgagdtpnpcnicrr.lrlrllyelakel
00470351   1/1  rseeeledaeklaeklgiplivvdideeflealaelf......gptpnpcnlcnr.lrlelllelakel.
00502331   1/1  yvvdlseefaeevldpalkayalgegpypltvvlarnlifkalleiake.lgadaiatGht.........
00488581   1/1  qsd..........eleyarevaehlgiehhvvdide...eelldalpdvlaaldtpepvnlrsr.irlyl
00507461   1/1  lrgesdeelefvrelaeklgiplivvdvdelf...........laagngpnpcalcrr.lrygallelak
00478481   1/1  hivvdldeeflselvdpaipagalyegnypltcvlcrn.lif.klllevaeelgadavatGht.......
00494761   1/1  vlavhv.......dtgll.fpetlefaeelaerlgiplivvdldeefae..flallgglsegdppnpcal
00453911   1/1  ellgdellavtv.......dhglss...deedalelakklgidhelvidivdavdaflaal..egvtgpe
00483691   1/1  vrelaeklgiplivvdldelf...............kglnpcalarr.lryaallevar...gadalatG
00501281   1/1  ........................ekylcilckrlm..lriaeklalklgadaivtGes...........
00523631   1/1  vieisgeyedeved...........................llellkelgveavvtGdilsd........
00433811   1/1  llstsl............................arelevedlvell.kelgadavvf------------
00507391   1/1  alaealgiellvvdidpavdallkllgea......gpelkdltlgniqarlRmvllyalanll.......
00395381   1/1  g..........ldeleearavaehlgtehhevlitvdallaflpalagal.....dll------------
00516451   1/1  ldlivvrpdeslar.........ggklwekdpd.wccdilkveplkralkel.gfdaw------------


                         +         -         -         -         -         *         -:210
query           LLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFL
00521171   1/1  .......ddvadqtllnlyalnallglkilrPLlgldKeeirelakelglpeiskypsggcgscflprnp
00462131   1/1  rr.lrlyllyelarel.gadvvltGhgaDelfgGytkygdllkglaplgdlpkdqvyllarllg.llkre
00399771   1/1  ...........lkgadelrfgylrlallpglelraplldllfPllglskaeirel---------------
00510381   1/1  .gadvlltGhad...elfegylllrg.dglkg................irPlldlskeevrelarelglp
00470351   1/1  gadvlatGtgaddeietgyltllgd.dgikdlsyvlg.lpeelllklirPlldlt---------------
00502331   1/1  ...lddndevrfelyflallpglki...iaPlldlgllellrskeei-----------------------
00488581   1/1  larlark..gakvvltGegaDelfgGyptyrpdplarlllldlltlllgvlllrvdrmsmahglevrvPf
00507461   1/1  el.gadvlatGhhadDqaetvllnllrgsglkglqgillggl......rlirPLldltkdeireyakelg
00478481   1/1  .....addlddvrferlflallpelgviaplrpllglskaeirelak-----------------------
00494761   1/1  crr.lklepllraake.lgadaiatGh..rrddsae.rallrllrgd............gg---------
00453911   1/1  pkdktigniqarlrmvalyal.anklgalvlgtgdv....................sEtllgyltkygdg
00483691   1/1  hhl..dDqaetvllnllrgsglkglagikelaldggl...........rlirPLlelskeeirayakelg
00501281   1/1  ....lgqvasqtlenlllidalnlpvlrPLigldkeeiielareigt-----------------------
00523631   1/1  .........yqrlrvegvcarlglkvlaPLwgldqeellrelielgleaiivk-----------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ...........gglvlgT.gnlsElalgyftkyGdggldiaPladly-----------------------
00395381   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHP
00521171   1/1  ftkallelle.eaeeildeeglvlglhlgllqyt------------------------------------
00462131   1/1  iralglelrvPfldeelvelalglpl..aykidgggic..eklilrealegyl...pgeildrk..Krgf
00399771   1/1  ----------------------------------------------------------------------
00510381   1/1  eeilekppsadlgf.......gqldeellglpyeeldailevlelgehaglvs.iigla-----------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00488581   1/1  ldhrlvefalslppelkpiggltKtllrelarelgllP--------------------------------
00507461   1/1  lpviedps--------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00453911   1/1  gldlrPlldlyKtevralarelglpeeiiekppsaelep-------------------------------
00483691   1/1  lpyiedpsnydldfr-------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RLMSVGLIAQQLHWVDREPFTGTLRCTVKTRYRQTDIPCTINALDDDRIEVIFDEPVAAVTPGQSAVFYS
00521171   1/1  ----------------------------------------------------------------------
00462131   1/1  hvglgywtigqlkglald----------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GEVCLGGGIIEQRLPLTV----------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------