[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68462.1


[Show Plain Result]

## Summary of Sequence Search
   1::305
 177::305  2.8e-32 36.3% 0040234 00402341 1/1   sphogluconate dehydrogenase C-terminal  
   1::183    2e-19 19.6% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
   1::177    1e-17 25.4% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
   1::176  8.3e-17 25.1% 0047869 00478691 1/1   )-binding Rossmann-fold domains         
   1::175  1.5e-15 26.5% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
   1::223  1.6e-14 27.1% 0047550 00475501 1/1   )-binding Rossmann-fold domains         
   1::174  1.5e-13 22.6% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
   1::172  1.9e-13 23.9% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
   1::176  5.6e-13 27.8% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
   1::176  1.2e-12 22.6% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
   1::103  5.2e-12 28.3% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
   1::176    3e-11 25.3% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
   1::46     4e-10 44.2% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
   1::98   4.6e-10 21.6% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
   1::178    1e-09 21.8% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
   1::108  1.9e-09 20.0% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   1::102    4e-09 24.0% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
   1::40   5.6e-09 37.5% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
   1::165  2.4e-07 22.2% 0042866 00428661 1/1   )-binding Rossmann-fold domains         
   1::42   2.6e-07 38.5% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
   1::105  3.2e-07 26.0% 0049730 00497301 1/1   )-binding Rossmann-fold domains         
   1::30   5.6e-07 33.3% 0045795 00457951 1/1   otide-binding domain                    
   1::153  1.4e-06 19.2% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   1::48     2e-06 39.6% 0051873 00518731 1/1   )-binding Rossmann-fold domains         
   1::30   2.2e-06 33.3% 0045870 00458701 1/1   AD(P)-binding domain                    
   1::30   2.4e-06 36.7% 0049990 00499901 1/1   otide-binding domain                    
   2::128  2.4e-06 19.0% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
   1::39   2.6e-06 35.9% 0045718 00457181 1/1   )-binding Rossmann-fold domains         
   1::30   2.6e-06 33.3% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::30   2.6e-06 43.3% 0052963 00529631 1/1   AD(P)-binding domain                    
   1::30   2.7e-06 40.0% 0043577 00435771 1/1   AD(P)-binding domain                    
   1::139  2.8e-06 23.4% 0040651 00406511 1/1   )-binding Rossmann-fold domains         
   1::39   2.9e-06 43.6% 0050212 00502121 1/1   )-binding Rossmann-fold domains         
   1::85   2.9e-06 21.7% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
   1::39   3.5e-06 35.9% 0048585 00485851 1/1   )-binding Rossmann-fold domains         
   1::30   3.6e-06 33.3% 0048607 00486071 1/1   AD(P)-binding domain                    
   1::92   3.7e-06 29.5% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
   1::30   4.3e-06 36.7% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::30     5e-06 33.3% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::141    5e-06 21.5% 0053322 00533221 1/1   AD(P)-binding domain                    
   1::30   5.6e-06 33.3% 0050363 00503631 1/1   AD(P)-binding domain                    
   1::141  5.7e-06 22.6% 0048009 00480091 1/1   AD(P)-binding domain                    
   1::71     7e-06 25.4% 0048807 00488071 1/1   otide-binding domain                    
   1::30   7.3e-06 36.7% 0036459 00364591 1/1   otide-binding domain                    
   1::30   7.6e-06 33.3% 0046834 00468341 1/1   AD(P)-binding domain                    
   1::30   8.2e-06 36.7% 0049150 00491501 1/1   AD(P)-binding domain                    
   1::30   8.7e-06 40.0% 0047141 00471411 1/1   otide-binding domain                    
   1::40     9e-06 27.5% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
   1::30   9.4e-06 30.0% 0045881 00458811 1/1   AD(P)-binding domain                    
   1::30   9.9e-06 30.0% 0048771 00487711 1/1   AD(P)-binding domain                    
   1::30     1e-05 40.0% 0047712 00477121 1/1   AD(P)-binding domain                    
   1::77   1.1e-05 30.7% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
   1::30   1.3e-05 30.0% 0046057 00460571 1/1   otide-binding domain                    
   1::30   1.4e-05 36.7% 0048356 00483561 1/1   AD(P)-binding domain                    
   1::30   1.4e-05 33.3% 0052926 00529261 1/1   AD(P)-binding domain                    
   1::30   1.5e-05 30.0% 0046579 00465791 1/1   AD(P)-binding domain                    
   1::30   1.7e-05 33.3% 0049222 00492221 1/1   AD(P)-binding domain                    
   1::43   2.2e-05 37.5% 0048757 00487571 1/1   )-binding Rossmann-fold domains         
   2::141  2.4e-05 17.8% 0048583 00485831 1/1   AD(P)-binding domain                    
   1::39   2.7e-05 30.8% 0046123 00461231 1/1   )-binding Rossmann-fold domains         
   1::128  2.9e-05 19.5% 0036889 00368891 1/1   AD(P)-binding domain                    
   1::87   2.9e-05 18.4% 0042446 00424461 1/1   AD(P)-binding domain                    
   1::141  2.9e-05 25.7% 0050927 00509271 1/1   AD(P)-binding domain                    
   1::46   3.4e-05 37.0% 0048027 00480271 1/1   )-binding Rossmann-fold domains         
   1::140    4e-05 17.2% 0047565 00475651 1/1   AD(P)-binding domain                    
   1::30   5.2e-05 33.3% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::30   5.4e-05 37.9% 0035989 00359891 1/1   AD(P)-binding domain                    
   1::160    6e-05 20.1% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   1::141  7.8e-05 21.3% 0048045 00480451 1/1   AD(P)-binding domain                    
   1::141  7.9e-05 20.4% 0048866 00488661 1/1   AD(P)-binding domain                    
   1::30   8.3e-05 33.3% 0036300 00363001 1/1   AD(P)-binding domain                    
   1::30   9.3e-05 33.3% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::30   0.00011 43.3% 0046156 00461561 1/1   otide-binding domain                    
   1::77   0.00011 25.8% 0048687 00486871 1/1    N-terminal domain                      
   1::30   0.00013 40.0% 0040049 00400491 1/1   AD(P)-binding domain                    
   1::30   0.00013 33.3% 0049003 00490031 1/1   AD(P)-binding domain                    
   1::43   0.00015 27.9% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   1::30   0.00015 23.3% 0047022 00470221 1/1   AD(P)-binding domain                    
   1::30   0.00017 26.7% 0052313 00523131 1/1   AD(P)-binding domain                    
   1::30   0.00018 36.7% 0046446 00464461 1/1   AD(P)-binding domain                    
   1::42   0.00021 33.3% 0043507 00435071 1/1   )-binding Rossmann-fold domains         
   1::30   0.00024 33.3% 0047270 00472701 1/1   AD(P)-binding domain                    
   1::30   0.00025 30.0% 0040035 00400351 1/1   AD(P)-binding domain                    
   1::30   0.00025 31.0% 0050960 00509601 1/1   AD(P)-binding domain                    
   1::30   0.00028 23.3% 0036654 00366541 1/1   AD(P)-binding domain                    
   1::136  0.00028 21.7% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
   1::30   0.00029 23.3% 0038449 00384491 1/1   AD(P)-binding domain                    
   1::64   0.00029 20.3% 0040602 00406021 1/1   AD(P)-binding domain                    
   1::39   0.00031 35.9% 0051213 00512131 1/1   )-binding Rossmann-fold domains         
   1::30   0.00032 33.3% 0047133 00471331 1/1   AD(P)-binding domain                    
   1::46   0.00032 39.1% 0047346 00473461 1/1   )-binding Rossmann-fold domains         
   1::30   0.00034 33.3% 0047029 00470291 1/1   AD(P)-binding domain                    
   1::39   0.00037 30.8% 0047263 00472631 1/1   )-binding Rossmann-fold domains         
   1::92   0.00037 26.1% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::30   0.00041 33.3% 0052032 00520321 1/1   AD(P)-binding domain                    
   1::40   0.00051 25.0% 0053321 00533211 1/1   AD(P)-binding domain                    
   1::30   0.00052 36.7% 0048865 00488651 1/1   AD(P)-binding domain                    
   1::30   0.00053 36.7% 0044098 00440981 1/1   AD(P)-binding domain                    
   1::30   0.00058 30.0% 0045518 00455181 1/1   AD(P)-binding domain                    
   1::42   0.00067 33.3% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::46   0.00068 39.0% 0052803 00528031 1/1   )-binding Rossmann-fold domains         
   1::30    0.0007 30.0% 0046750 00467501 1/1   AD(P)-binding domain                    
   1::30   0.00074 30.0% 0040688 00406881 1/1   AD(P)-binding domain                    
   1::30   0.00075 27.6% 0047682 00476821 1/1   AD(P)-binding domain                    
   1::111  0.00079 25.5% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   1::90    0.0008 24.4% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
   1::56   0.00097 21.4% 0050364 00503641 1/1   AD(P)-binding domain                    
   1::305


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
00402341   1/1  ----------------------------------------------------------------------
00463571   1/1  mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgldelveellgnltattdlee
00481021   1/1  lllmlkmmkiaviGaGavGtalAallaengheVtlwdrneekvellnekgenpiylpglelp..enltat
00478691   1/1  mkitilGaGaiGsLwalallkqghnvslllrssqpllsln....lldldglslslqlplndle.llsssd
00509101   1/1  mkigiiGaGnmGralaagLlkaGhsevtvanrtpekaealaeeg............gvvaaslaealada
00475501   1/1  MkiaiiGGtGniGsalAlrLaaaGheVvvvsrspekaealaeeglnllylpgvtaa.....dlaeaaega
00528371   1/1  mkkvgiiGlGlmGlslalalaraGfadeVvgydrnpeklekalelgat.........dliaatdlaealk
00355351   1/1  GkkvaviGlGsmGlalAallaaaGheVlvwdrdpekveelaelgapvakylpglellgrlrattd.....
00517971   1/1  mkigiiGaGnmGsalakgllkaghevvvadrspekaeelaeel............gvtaatsleelleda
00502691   1/1  kkvgiiGlGlmGlalarnlaaaGyeVvvydrspeklealaalgaeva............aslaealadad
00487551   1/1  mmkigviGlGlmGlplalnlakagheVvvydrnpekvealkelgapile....lknltaatsleelvell
00523291   1/1  kkvgviGlGlmGlalalnlak.gfevvvydrtpekaealaelg............av.aaslaealaead
00482271   1/1  mkiaviGaGyvGlplAallaeaGheVvgvDideekvealndgilpi------------------------
00445591   1/1  pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldilelllve.rlitttdleealad
00504431   1/1  lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeiaklllklvlkgllvelllgaala
00425341   1/1  lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpekleglaadladilelllvkgrirattdl
00472761   1/1  ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideekleglardlldile
00479921   1/1  pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerle------------------------------
00428661   1/1  mfltlnvrelliklkllrlggleellvlalvyydddadlellkgkkiaviGyGsmGlaiAlnLrdsgldV
00466731   1/1  mlkikkvaViGaGlmGsgiAavlaaaGikVvlvDidpealek----------------------------
00497301   1/1  lkiavlGaGswGtaLAvlladnghevllwgrrldpelveelnadrenkrylpgvllpnllattdleeale
00457951   1/1  yDVvIiGaGpaGlsaAlrLaraGldlgsel----------------------------------------
00475161   1/1  hgkkvgiiGlGniGkavakllkgfgmevlaydrrpke....................gavyvsldellae
00518731   1/1  mkiaviGaGnyrlyaaagitnfaraaevaeevgkpeialthstitlga----------------------
00458701   1/1  ydVvvvGAGiaGlaaAlrLaeaGltdvlvl----------------------------------------
00499901   1/1  kkdvvviGAGiaGlaaAlrLaeaGhkVtvl----------------------------------------
00383791   1/1  -pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqllaaaGvgkvilvDrdeea
00457181   1/1  mKiaviGaGyvGlslalllalkgladevvlvDideekle-------------------------------
00484941   1/1  aakkydvvIiGaGpaGlaaAlrLaraGlkV----------------------------------------
00529631   1/1  mptkkdVaiIGAGpaGLaaAllLaraGhdl----------------------------------------
00435771   1/1  MkdVaviGAGiaGlaaAyeLaraGlkVtvl----------------------------------------
00406511   1/1  mhviiiGlGrvGlalarlLlelgidvvvidideerveelrelg....vlvvvgdatdedvLeeagiedad
00502121   1/1  kkmKiaviGaGsvgtalalllalnlleelsglghevvlv-------------------------------
00531721   1/1  rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvlvDidevklsnlardllhilad
00485851   1/1  mKiaviGaGnvgsalalllalagladelvlvDideekle-------------------------------
00486071   1/1  myDvviiGaGpaGlaaAlrLaraGlkVlvl----------------------------------------
00479091   1/1  mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlverdprpelallllelleklgvevllgtr
00462741   1/1  mlMkkkyDviiiGaGpaGlaaAleLaraGl----------------------------------------
00374411   1/1  Mpvligllesliidtalllgllpplsaskk----------------------------------------
00533221   1/1  ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld........
00503631   1/1  masmsmkydvvIiGaGpaGlaaAlrLaraG----------------------------------------
00480091   1/1  ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld........
00488071   1/1  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVt
00364591   1/1  mgrvcppcegaclllllagpvailllepal----------------------------------------
00468341   1/1  smasesdydvvIiGaGpaGlsaAlrLaral----------------------------------------
00491501   1/1  Mirvcpalceslvvlaaglepplpplsask----------------------------------------
00471411   1/1  mstkkdvaiiGaGpaGlsaAiyLaraGldd----------------------------------------
00472781   1/1  ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalal------------------------------
00458811   1/1  llydvvIiGaGpaGlsaAlrLaraGlkVlv----------------------------------------
00487711   1/1  kydvviiGaGiaGlsaAleLarrGlkdVtv----------------------------------------
00477121   1/1  ektdVaIvGAGpaGlaaAlaLaraGldvtv----------------------------------------
00533831   1/1  lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtlvDiddelle.glalelgdiis
00460571   1/1  pmmskkkdvvViGaGiaGlsaAlaLaraGy----------------------------------------
00483561   1/1  MskkydvviiGaGiaGlsaAlrLaraGlkV----------------------------------------
00529261   1/1  lniksielflsiieraldeglvppsmemmm----------------------------------------
00465791   1/1  mkeyDvvIiGaGiaGlsaAlrLakaGlkVl----------------------------------------
00492221   1/1  Mmktpvliklleslladtalrlpplpplsl----------------------------------------
00487571   1/1  llmkigfiGlGvmGlnlalnllkagfevtvynrtaekaeelva---------------------------
00485831   1/1  -lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpelggtclaaggipskallllalgllllela
00461231   1/1  mkmKvaviGaGyvGlalalllallglaelvlvDideekl-------------------------------
00368891   1/1  ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglld........
00424461   1/1  vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlggtlla
00509271   1/1  vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtil..........................
00480271   1/1  mhviiiGlGrvGrlvarlLlelgidvvvidldpervellaellgvl------------------------
00475651   1/1  pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlggtld.......
00481861   1/1  kkvlvtGAsGgiGsalalllaargaevvll----------------------------------------
00359891   1/1  MkeldeeyDvviiGaGpaGlsaAlrLaraG----------------------------------------
00421801   1/1  DgigavsllkrllvdlpgkkvlvlGaGgiGralalalaaagaevvvvnrtlekaeelaeelga.......
00480451   1/1  pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglld.........
00488661   1/1  srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlvergdrl
00363001   1/1  mekydvvviGaGlaGlsaAlelaragldvt----------------------------------------
00462701   1/1  MMsplllalllllpllllaldeeydvvviG----------------------------------------
00461561   1/1  gkkvaviGaGpaGlaaAllLakalpghdvt----------------------------------------
00486871   1/1  llllllkikkvafiGlGgmGmsalAllllkaGyeVtgsDlndpallelleelgievvlghdaella....
00400491   1/1  MkdleyDvvvvGaGpaGlaaAlalaragpd----------------------------------------
00490031   1/1  lMlpeslleplpalsaseeydVvViGaGpa----------------------------------------
00423401   1/1  aGylavllaalllcrflgglgllltlagglagkkvlviGaGgv---------------------------
00470221   1/1  myDVvviGgGiaGlaaAlrLaraGlkVlvl----------------------------------------
00523131   1/1  msydVvvvGAGiaGlsaAlaLarrGlrvll----------------------------------------
00464461   1/1  MmplslllatalelplpalaldkkyDvvVi----------------------------------------
00435071   1/1  rmKiaviGaGsvgtalalllalkgldelpvgevvlldideer----------------------------
00472701   1/1  ledllldllsmstkkdvvviGaGpaGleaA----------------------------------------
00400351   1/1  MeyDvvvvGaGpaGlaaAlrLaraGlkVlv----------------------------------------
00509601   1/1  kdvvviGgGpaGleaAlalar.glkvtlie----------------------------------------
00366541   1/1  vlpipgldgegvltsrdlldllelpkdvvv----------------------------------------
00452431   1/1  tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarllaalGakVi
00384491   1/1  lpgvellltsddalaleelpkdvvviGgGp----------------------------------------
00406021   1/1  MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllgggllnagdildklgllaal------
00512131   1/1  mkkvaiiGaGyiGlslalllaekgllgkvvlvDiseerl-------------------------------
00471331   1/1  tmkydvviiGaGpaGlaaAlrlaraGlkvl----------------------------------------
00473461   1/1  klkmhviiiGagrvGrslarlLleegidvvvidrdperveelaeel------------------------
00470291   1/1  lllllslsllllllsslllmmskeyDvvii----------------------------------------
00472631   1/1  amKvaviGaGsvglalalllalggladelvllDideekl-------------------------------
00496861   1/1  AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelgad
00520321   1/1  MmdeeyDvviiGaGpaGlsaAlrLaraGlk----------------------------------------
00533211   1/1  mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgg------------------------------
00488651   1/1  mlpkdvviiGgGpaGleaalalarlglkle----------------------------------------
00440981   1/1  MeskkydvvviGaGpaGlaaAlylaraglk----------------------------------------
00455181   1/1  MseydvvviGgGpaGlaaAlrlaeaGlkvl----------------------------------------
00367851   1/1  kgkkvlviGaGgiGralaraLaeaGaevtvadrslekaeala----------------------------
00528031   1/1  nhviiiGlgrvgqllarlL.e.gidvvvidldeerveelrelgvlv------------------------
00467501   1/1  kkkdvvvvGgGpaGltaAlrlarlgpdlev----------------------------------------
00406881   1/1  MsskeydvvviGgGpaGlaaAlrlaraGlk----------------------------------------
00476821   1/1  lallslllllllglllalpdlamdkeyDvv----------------------------------------
00484541   1/1  mmkklkvaiiGaGniGlalarallalaggaevvavadrdpekaglalakelgatttvn...avddleell
00470321   1/1  llGdntdglgavellerlggdlkgktvlviGaGgiGravaralaaaGakrvvvanrtpekaeelaeel..
00503641   1/1  epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakagl--------------


                         -         -         *         -         -         -         -:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
00402341   1/1  ----------------------------------------------------------------------
00463571   1/1  alkdaDlviiavgtplkdgdgrpdldivnavaeeiakllgpdtivvsstvpvgtteylatpllgidvlss
00481021   1/1  tdleeavkdadlviiavptdalrsvlrqlakllkdvllkkgaiivsltsgi.pvgtlallseiieevlg.
00478691   1/1  lllvtvKayqvlealkpllpklaadtlilllhNGlGtleevkel..dnpillgttthgalkdgnl.vlht
00509101   1/1  dvvilavkpqaveevlaelag...kgalvidiaagip.ieelaealpeaglvvrdmpnlgalv.......
00475501   1/1  Dvvilavppeavrevleelapll.egkivvdvtngl.pidtllll.........................
00528371   1/1  daDvvilavptpavrevleellpllkpgailidvssgkpittealaealgervigahpvsggevgapega
00355351   1/1  ........leealadaDvvilavptpavrsvlaelapllkpgaivvdlstglvgtieallaallegvlal
00517971   1/1  Dvvilavppqlveevlkalkp....gklvidvaagid.iealaealkeggivvrvapntgal........
00502691   1/1  vvilavplpaavkavlnglaellallkpgailidvssglpvdtealaaalaeggilvaglpvfggep...
00487551   1/1  kdadvvilavptpsavkevlegllpllkpgaiv-------------------------------------
00523291   1/1  vvilavpapaavrevlegllpllkpgaividlstgspldtealaealeekgilfldapvsggepgaragp
00482271   1/1  ----------------------------------------------------------------------
00445591   1/1  aDvviiavgtprkpgmlrldlladnlgi------------------------------------------
00504431   1/1  ritgttdlealadadlVieavpenldvklavlaeleallkpgailasntssls.italadalgrpgrvig
00425341   1/1  yealkgaDvviiavgvprkpgl...iaellkrgdllvt--------------------------------
00472761   1/1  llgvglvv..ttdleealkgaDvviiatgvpr--------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00428661   1/1  vlydrnevglrkgssslekaeelgvill........vltvadlaeavagADlvilavpdeatadvleeia
00466731   1/1  ----------------------------------------------------------------------
00497301   1/1  gadlvllavPsqalrevlkqlkpllk.daiivsvt-----------------------------------
00457951   1/1  ----------------------------------------------------------------------
00475161   1/1  sDvvvlcapl...eaineealaalkkgailintsrgalvdeeallelleagkiagagldvlsgeplgldp
00518731   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00383791   1/1  lerarrlgpdvvvdpie...dlaeallellggrgvDlvldcvdnf...etlallidal------------
00457181   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00406511   1/1  avvvatgddeenllivllarklnpvlkiiarardpehaellrk........lgadlvispeleaalrla-
00502121   1/1  ----------------------------------------------------------------------
00531721   1/1  lgvpkvv..vanlee-------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00479091   1/1  vteiakeylpelllgveveagd------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00533221   1/1  .................................eelslallelleklgvelllgtrvtaidvdgdg....
00503631   1/1  ----------------------------------------------------------------------
00480091   1/1  .................................eelsllllelleklgvelllgtrvtaidvdgdgvt..
00488071   1/1  l---------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00533831   1/1  llgkalk---------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00485831   1/1  allgillllllld.....lllllrrllllllllaagvegllillgvevvvgvadgggvtvvtgdgetira
00461231   1/1  ----------------------------------------------------------------------
00368891   1/1  .................................pelaaallelleklgvevllgtevt------------
00424461   1/1  lgripakllglealllr-----------------------------------------------------
00509271   1/1  ...llggvpsglllgaalllallelleklgveillgtevtsidld......ggtvvgvttgdgetltad.
00480271   1/1  ----------------------------------------------------------------------
00475651   1/1  ..................................pelskallelleklgvelllgtevtaidgdgdgvvv
00481861   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00421801   1/1  ...qgdvsdleeleealggaDivvnatgaglpglllelllellkpggvvvdvayppllttallplararg
00480451   1/1  ................................pelaaallelleklgvelllgtrvtaidldgggvt.vt
00488661   1/1  ggtlld........................................eelaaallelleklgvevllgtrv
00363001   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00486871   1/1  .......---------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00452431   1/1  vydrspekleel...............dglgvdsleellkeaDvvilavpltpetkglin.aella----
00384491   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00472631   1/1  ----------------------------------------------------------------------
00496861   1/1  vvldvtd....veellkallkl------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00484541   1/1  adp...gvDvvieatpa...gahaevalaaleagkhvvvek-----------------------------
00470321   1/1  ..........ggeavsldel--------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
00402341   1/1  ------------------------------------dillaiweKllvnaainpltallglpngellasp
00463571   1/1  Pefl...regaallhllnpdrvvvgslspeaaerlralyesll---------------------------
00481021   1/1  ghpfavlsgPefarevaeglptavtiagedeeaaell---------------------------------
00478691   1/1  glGltqlGplngsal.slelladllnqalpdvawle----------------------------------
00509101   1/1  .gagataltllaggdeealelvepllealgkvvvv-----------------------------------
00475501   1/1  .....................vlsgpslaeevaellpgarvvkafntiaaarladlfaglgflvlvagdd
00528371   1/1  ladlfegplvi.ltpmaggdeealelvlplleal------------------------------------
00355351   1/1  agldvldaplsgpeflaeggalllvanvlltp--------------------------------------
00517971   1/1  vgagatalvagagvdeealelvlellealgkvvvve----------------------------------
00502691   1/1  ......gaglgvltphvggdeealervlpllealgk----------------------------------
00487551   1/1  ----------------------------------------------------------------------
00523291   1/1  ........ltimaggdeealervrpllealgavvyv----------------------------------
00482271   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00504431   1/1  lhffnp.........vplmplvelvpgegtspetlerv--------------------------------
00425341   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00428661   1/1  pllkpgail.sfahGi.sidelala---------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00475161   1/1  lleldnviltphi---------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00533221   1/1  .---------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480091   1/1  .---------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00485831   1/1  d---------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00509271   1/1  v---------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00421801   1/1  lgrivdglsmlvlqgapg.f--------------------------------------------------
00480451   1/1  l---------------------------------------------------------------------
00488661   1/1  t---------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00472631   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
00402341   1/1  ...dllralldEalavaralgvelpddllerlvlavlelt..ganksSMlqDleagrptEidainGavvr
00463571   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00478691   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00475501   1/1  eealklvialaag---------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00472631   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGAQNNIAVPVNKLLTQLIHAKEAQ---------------------------------------------
00402341   1/1  lakalgvptPvldtlyallkalelr---------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00478691   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00435071   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00473461   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00472631   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00528031   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------