[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68493.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 277::325  2.4e-10 32.7% 0046275 00462752 2/2   domain-like                             
 277::324  2.3e-09 33.3% 0045977 00459771 1/1   domain-like                             
 223::274  3.8e-08 34.6% 0036286 00362861 1/2   domain-like                             
 223::274  6.4e-08 32.7% 0035607 00356071 1/2   domain-like                             
 275::325  9.5e-07 32.0% 0035607 00356072 2/2   domain-like                             
 275::325    2e-05 30.0% 0036286 00362862 2/2   domain-like                             
 225::276       45 32.7% 0046275 00462751 1/2   domain-like                             
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQSSPVLHGDIEEIALPGGICITRSDVH
00462752   2/2  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00462751   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTFLLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMY
00462752   2/2  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00462751   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PDGGWRERLPVSLADEWENSATSARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQ
00462752   2/2  ----------------------------------------------------------------------
00459771   1/1  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362862   2/2  ----------------------------------------------------------------------
00462751   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PATQKRGLPVTGEYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLA
00462752   2/2  ------------------------------------------------------------------lRle
00459771   1/1  ------------------------------------------------------------------lRle
00362861   1/2  ------------dderleralelleanldeplsleelAaavglspshfsrlFkkltgltpleYl------
00356071   1/2  ------------ddlrleralelleenlaedlsleelAalvgfspshfsrlFkkltgltpseYr------
00356072   2/2  ----------------------------------------------------------------ddlrle
00362862   2/2  ----------------------------------------------------------------dderle
00462751   1/2  --------------lRlelAkrlLlet...dlsiaeiAlelGfsslsaFsraFkklfgvtPseyrk----


                         -         *         -         -         -         -         +:350
query           RARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA----------------
00462752   2/2  lAkrlLletdlsiaeiAlelGfsslsaFsraFkklfgvtPseyrk-------------------------
00459771   1/1  lAkrlLletdlsiaeiAlelGfsslsaFsraFkklfgvtPseyr--------------------------
00362861   1/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00356072   2/2  ralelleenlaedlsleelAalvgf.spshfsrlFkkltgltpse-------------------------
00362862   2/2  ralelleanldeplsleelAaavgl.spshfsrlFkkltgltple-------------------------
00462751   1/2  ----------------------------------------------------------------------