[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68510.1


[Show Plain Result]

## Summary of Sequence Search
   1::555
   9::337 1.1e-104 36.5% 0038263 00382631 1/1   otidylyl transferase                    
  27::346 1.8e-100 43.7% 0047487 00474871 1/1   otidylyl transferase                    
 340::549    3e-84 53.6% 0038262 00382621 1/1   omal protein L25-like                   
  26::331  5.8e-62 33.6% 0048474 00484741 1/1   otidylyl transferase                    
  10::333  1.6e-59 30.2% 0038403 00384031 1/1   otidylyl transferase                    
  19::316  9.3e-56 27.3% 0047412 00474121 1/1   otidylyl transferase                    
   6::334  1.4e-42 25.7% 0037568 00375681 1/1   otidylyl transferase                    
   6::325    1e-34 27.5% 0039171 00391711 1/1   otidylyl transferase                    
  23::334  1.4e-23 26.0% 0038030 00380301 1/1   otidylyl transferase                    
  18::311  1.8e-19 22.1% 0035691 00356911 1/1   otidylyl transferase                    
  17::128  4.7e-17 22.2% 0048275 00482751 1/1   otidylyl transferase                    
   5::124  5.8e-16 34.2% 0039071 00390711 1/1   otidylyl transferase                    
   5::124    1e-12 27.5% 0040507 00405071 1/1   otidylyl transferase                    
  23::124  2.1e-09 32.7% 0052384 00523841 1/1   otidylyl transferase                    
   1::223  3.1e-06 24.5% 0039322 00393221 1/1   otidylyl transferase                    
  12::93   2.8e-05 20.3% 0047114 00471141 1/1   otidylyl transferase                    
  28::105  5.3e-05 19.5% 0046259 00462591 1/1   otidylyl transferase                    
  23::124  9.9e-05 32.2% 0042947 00429471 1/1   otidylyl transferase                    
  24::124  0.00023 29.0% 0043348 00433481 1/1   otidylyl transferase                    
   1::555


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
00382631   1/1  --------lWeeegifekdllkgkkkfvvtrfpPsPtGyLHiGharnallndllarylrGyfvlriedtD
00474871   1/1  --------------------------kvvtRfAPsPtGylHiGhartallnyllaraygGkfllrieDtD
00382621   1/1  ----------------------------------------------------------------------
00484741   1/1  -------------------------tkvvvrfaPnPtGplHiGharsaligdllarylrGydvlridDtD
00384031   1/1  ---------PgfinlklieekllkiweelklfgklflpkgkkkvvvtfppPypnGplHiGHarsailgDv
00474121   1/1  ------------------fppgkgkkvvversspnptgplHiGHarsavigdalaRllralGydVlrvng
00375681   1/1  -----lalyntlnlpleefplrynlkeieekwqkyweekklfeallpllggkkkfyvtdppPypnGplHi
00391711   1/1  -----ynpleieeeilkkl...kkkkvvvvrtgpyPtGplHiGhargallgdvlarylrmlGydvlfvlg
00380301   1/1  ----------------------ialpgfinlflieekllklweeeklfefllegkkkfvvtvppPypnGp
00356911   1/1  -----------------pflpgkkkkvvvefssPnptgplHiGHarsaiigdalarllrflGydVlrvng
00482751   1/1  ----------------gmslllklllirgllneltdekelfellegkpvrvycGptPtgplHlGhartal
00390711   1/1  ----etalpkfynllliekkwqkfweekklfeaflpldpgkkkfyvttppPypnGllHiGHarnyvlaDv
00405071   1/1  ----elklyntweekklffkpldkkkvvvtvpgpyvngllHiGHarsyilgDvlaRylrmlGydVlfvpg
00523841   1/1  ----------------------gkkkflitvpppyvngplHlGhartyilaDvlaRylrmlGydvlfvpg
00393221   1/1  kenlelierglielwreeelfellekkkvrvy..tgpdPtgslHlGhlrgaikldvlara.gydvlflig
00471141   1/1  -----------gmsvdellelllrglyntltdekelfklleggpvrvy..cGidPTgdslHlGhlvtadv
00462591   1/1  ---------------------------PlrvytGfdPTgslHlGhlvgalklrrllq.aghevilliaDl
00429471   1/1  ----------------------gkkkflitvpgpyvngllHiGHarnyilaDvlaRylrmlGydVlfvpg
00433481   1/1  -----------------------kkkflvtvpppyvngllHlGHarnayilaDvlaRylrmrGydVlfvp


                         -         -         *         -         -         -         -:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
00382631   1/1  pereteeyidailedlkwlglswdwsryyqserfdyyqelflkLlekGlayrcfctvewlpalrtalaea
00474871   1/1  perevpeavdailedlewlgldwdegpdpggplgvyyqserfdlyyeaaeeLiekglaYvcfctreelea
00382621   1/1  ----------------------------------------------------------------------
00484741   1/1  perlteeyidailedlkalgidwdeevrtqserldayqelfekllekGlayvcelsveflvel.......
00384031   1/1  laRylrmlGydvlfvlgiddhGlpiellaekfgedprelaeeyieeikedlkrlgisydwsreyattdpe
00474121   1/1  vddaGtqigllaaslllrgleepedlypieylldlyvklkklaedeeleeeagefllrledgdpkrlade
00375681   1/1  GHarnyilaDvlaRylrmrGydVlfvpgwDdhGlpielraeklgktpedlgreeflelcrelaeeyidei
00391711   1/1  idDtglpievkaeeegileeylgkpltgipdflgdprelaeeyideikedlkalgidpdwvsesslyksg
00380301   1/1  lHiGHarsailgDvlaRylrmlGydVlfvpgwDdhGlpiellaeklgiklllriddlgreeflelprela
00356911   1/1  iddwGtq......iellaeslkllglellgeipeisylgeyyveiakelielgkdytldpeleelareff
00482751   1/1  vlarflr.aGydvlfligDahgliidpagelglprelveenaaailedlkalgidpdk------------
00390711   1/1  laRylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetpr----------------
00405071   1/1  iddhGlpiellaeefgelpreladeyieefkedlkrlgisfdwfrptatlyiea----------------
00523841   1/1  tddhGlpielraeklgidpreladeyiaeikedlkrlgisfdw.fyrttdpeyi----------------
00393221   1/1  Dlhgliidpapkelvrenieeikeqllalgldp.....................................
00471141   1/1  lrrflra.gydvilligDltgli-----------------------------------------------
00462591   1/1  dalrvlldpeeirenileiiaqllalgldpdktvi-----------------------------------
00429471   1/1  wDdhGlpielkaekfge...............tpreladkyiaefkedlkrlgi----------------
00433481   1/1  gtDdhGlpielkaekfgetpreladeyidefkedlkrlgisfdw.fyrttdpey----------------


                         +         -         -         -         -         *         -:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
00382631   1/1  gvepkyrgrsrelnlelviattrpetlegdyalrlkidlesglenlrDwvisrqrywghdipllrsdglp
00474871   1/1  lrgkl..pgydgtcrdlsveenlalleegrpg.......vlRlkidldgpivfndllrgpvlfria.alg
00382621   1/1  ----------------------------------------------------------------------
00484741   1/1  .............nlfyygrlsngevpeleavlrllvd..lgklvprdlvlgalwi.dlpgdeddwvivw
00384031   1/1  yieavqeiflklyekGliyrgerpvnycpsdetaladaeveypvcwrskgdpvelrlteqwflklsklad
00474121   1/1  sieeikedlkrLgvdfdryvresesyysgavqeviekLlekGlayekel.....................
00375681   1/1  kedlkrlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladrevegypvcw
00391711   1/1  lykeiitrqseyieliqeilekllekglayekdgtvnflprc...ktalgdls................v
00380301   1/1  eeyideikedlkrlgisfdwfrpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaev
00356911   1/1  rkleegdeeylklwqklvdrsleefkedlkrlgvkfdvyrgestlyidg.iievvelleekgllyesdga
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ......................................................................
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
00382631   1/1  tyflavvvddallgithvlrGaDhlfntlryilllealglpfpkvlhhglvldldgekmSKskgnvvvpl
00474871   1/1  dfvllrsdgyptYdlavvvdDalmgiThvirGedlldstprqillyealglp.vPvyahlplllnldgtk
00382621   1/1  ----------------------------------------------------------------------
00484741   1/1  gdglpgYdlavvvddallgidivvrGkDllfphalyeallealglpp.peyvhhglvlnldgeKmSK...
00384031   1/1  rllealeelewrpevvrkrlewileglrdwciSRqrywGvpiPvwycescliesvydellpvvlgeleeg
00474121   1/1  ...lvndgavlfrlekfgddgeledrvllksdG.tptyllrDlaisrqrfwghpipgwespwgdvlptwf
00375681   1/1  rsgapvevrlteqwflklsklddr.......llkalkkgefvpeevknrlrnwlenlrDwcisRqrp.WG
00391711   1/1  evkkwgdgiplykak..................diadvwfdspwgygrpgyplecaaddlllgvdivlgG
00380301   1/1  epvcwrsgtpvevrlteqwflklgkladrllealeegervivpeevknrldnwleg..............
00356911   1/1  vyfdltkfgddlrdwvisr.........sdggytYftsdiayalyrferlgfdkdiyvvgadqllhfaql
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ...ekwtifrqsd---------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
00382631   1/1  dlidgygdprlptlaglrrrGyladalrlflallgpsksdlnfdlekledfnrklln-------------
00474871   1/1  LSKrk................gaptllglrrrgylpealrnfllllgwsksdalldfsllelierf----
00382621   1/1  -----------------------------------------------------------ApRlmavldpv
00484741   1/1  ..........Gnvtl.......lldegygpdalryfllrlgyssdldfsle-------------------
00384031   1/1  gllleadgdllsllgdlkdfvllksdgpleretdvldvWfdSgwgylrvlgyp-----------------
00474121   1/1  iellayvv...ddlgfdvdiyvvGadhilhferlra----------------------------------
00375681   1/1  vpiPvwh.iedgaivyvaediaylllkaieggtdllltlelldllvlyyvllgk----------------
00391711   1/1  kDhifphllylpaqrealealg.leppkvllyhgvvlgldgeKMS-------------------------
00380301   1/1  ...............................lrdwcisRqrywGvpiPgwhied----------------
00356911   1/1  faalaalgyepakkvlhvgfvlv.g.kMSkr---------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
00382631   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00382621   1/1  kvvienlpegl.ellevplhPknpelGtrevpfskelyiereDfreepdkkffrLapgeevrLrdlynii
00484741   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
00382631   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00382621   1/1  vkkvekdedgkvtellatydpetklglegdfkkvkgvihWvsaedavevevrlydrLftkenpeedddfl
00484741   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVFNRTVGLRDTWAKAGE-----
00382631   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00382621   1/1  dflnpnslvvlealvepsladlkvgdiiQfeRlGYfivDkvdskedklvfnrivdlkds-----------
00484741   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00462591   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------