[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68527.1


[Show Plain Result]

## Summary of Sequence Search
   1::722
 570::715  1.2e-30 39.0% 0048648 00486481 1/1   ike                                     
 423::547  5.7e-20 28.5% 0038399 00383993 3/3   ne H3 K4-specific methyltransferase SET 
 216::352  4.2e-18 29.2% 0038399 00383991 1/3   ne H3 K4-specific methyltransferase SET 
 643::714  6.4e-15 43.1% 0047832 00478322 2/2   ike                                     
 336::642  3.7e-13 31.0% 0047832 00478321 1/2   ike                                     
 353::416   0.0014 33.9% 0038399 00383992 2/3   ne H3 K4-specific methyltransferase SET 
   1::722


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISSDLKLLLADRYYFKDKTPCNTNT
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSARAESMGLTTEEYINKIRSLRPAILDDRYFYLTVDQCDAGGTPMLTGIELCTEALCGAEYMKRSSDLW
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDDELQPTVKRQATTVVHMPLPYDKEKKLWKVTGWYLESSEETGEVMQSKQIAFEGYTNEENFANRQRVS
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VFKSFYESGNLKSIYHYNAQNKRDGKAETYFDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQG
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  -----lfndglvyegef.knglrhGkgtlyypnGdi..yegeykngkrhGegvlyypnGklkyegewkng
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KIKDGECPHFYDNGVLKQKHSYLNQKLEGPAFEYFPDGKIKGKYSYSKGTIVGTSTEYYSTGKIRGVYHR
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  k.rhGegkyyypnGklyegetykngklhGegliyyyadgklvyegeykngelkreGlgklyyengklyeg
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  -------------------------------------------------------ngygvkgdyeeAlel
00383992   2/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NNQGENDGTFEQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ew--------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  yekaaelgpaeayynlglly......lgdyekAleyyeka..............................
00383992   2/3  --lfndglvyegefknglrhGkgtlyypnGdi.yegeykngkrhGegvlyypnGklkyegew.kng----


                         -         -         +         -         -         -         -:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  --lfndglvyegefknglrhGkgtlyypnGdi.yegeykngkrhGegvlyypnGklkyegewkngkrhGe
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ......................................................................
00383992   2/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEELSELYAPTDVT
00486481   1/1  ----------------------------------------------------------------------
00383993   3/3  gkyyypn.GklyegetykngklhGegliyyyadgklvyegeykngelkreGlgklyy-------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ......................................................................
00383992   2/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
00486481   1/1  ---------dpealfnlGlayyklgdyeeAielyekaaelgpadaqaylglgyllgygvlgdyekAleyy
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00478321   1/2  ..aepgnaeayynlGllylkGlgvlkdyekAleyyekaaelgpaeayynlGllylkGlgvlkdlekAlky
00383992   2/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLT
00486481   1/1  kkaaelgpanaqanlgllylnglgvlkdyekAlkyyekaaepgnaeayynlGllylkGlgvlkdyekAle
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  ------------GllylkGlgvlkdyekAleyyekaaelgpaeayynlGllylkGlgvlkdlekAlkyyk
00478321   1/2  ykkaaelgpeda----------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AAVKGGVKPALAALKELTPQTK------------------------------------------------
00486481   1/1  yykkaaelgpanaqa-------------------------------------------------------
00383993   3/3  ----------------------------------------------------------------------
00383991   1/3  ----------------------------------------------------------------------
00478322   2/2  kaaelgpedaqayL--------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00383992   2/3  ----------------------------------------------------------------------