[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68745.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
 143::405  1.5e-13 21.2% 0036388 00363881 1/1   hydrolase                               
 142::405  4.6e-09 20.4% 0051447 00514471 1/1   hydrolase                               
 142::406    5e-08 20.1% 0047668 00476681 1/1   hydrolase                               
 139::407    4e-06 17.6% 0050207 00502071 1/1   hydrolase                               
 144::401  0.00014 23.4% 0046880 00468801 1/1   hydrolase                               
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVR
00363881   1/1  ----------------------------------------------------------------------
00514471   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------
00502071   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLG
00363881   1/1  ----------------------------------------------------------------------
00514471   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------
00502071   1/1  --------------------------------------------------------------------sk
00468801   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
00363881   1/1  --krivllGDSltagy...................glgsggagWgdlLasyl..gvevvNlaisGatt..
00514471   1/1  -plrilllGDSitagygasgp...................gggwpallaellaarfgrgvtvinlGisGd
00476681   1/1  -plrilllGDSitagygl....................spgggwpallaealgagvtvinlgisGdtt..
00502071   1/1  kplrivalGDSitagygd..ppgggwvgllaallaalgp.gvtv..............inlGvsGdttag
00468801   1/1  ---lllallllpvllllgllvwlsllalalalakekplrilflGDSitagwgls........ggwrella


                         -         -         -         +         -         -         -:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
00363881   1/1  .......rsflaegrldavldllkkpdlvliefGhNDakllgldnlrlllpglgkellvlvlnlrgvpvd
00514471   1/1  tt.........adllarldrlllalkp...dlvvillGtNDllllrgvsleefaanlralidrlrapgak
00476681   1/1  .......adglarldalllalkp...dlviillGtNDll..rgvspeefranlralierlra.pgakvvl
00502071   1/1  lla............rleellllrlealkpdlvvlllGtNDllrvlgrpgvsl..eeyrenlrailellr
00468801   1/1  ...................glevinlGisGdtt.........adllarleedvldnlkp...dlvvlmlG


                         -         *         -         -         -         -         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYD
00363881   1/1  efkanleaiidrlraagakvvlltplprln...................................fgs.g
00514471   1/1  .vvlvtpppvge...............lpnrlnerlaaynaalrelaaelgvpfvdlysalldlaglpe.
00476681   1/1  vtpppp..................pnylndylaalndalrelakelgvplvdlfallldldg........
00502071   1/1  .pgakvllvgpppvpelllp..............rlnervaelnaalrelaeelgvpfvdlf........
00468801   1/1  tNDl......gl..speeiaenlralieliraklPgakilllgllpvgerp........nylnerikeln


                         -         -         -         -         *         -         -:420
query           TENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE------------
00363881   1/1  tlrryleayneaarelAeelgv....plvDlfallaellndlgpaglpdyflaDg---------------
00514471   1/1  ..............................lllpDglHpnaaGyrllaealaeal---------------
00476681   1/1  .........................elllaDglHpnaaGyrliaealaeallkllg--------------
00502071   1/1  ......................sllldeegllpellaaDglHpnaaGyeliaealle-------------
00468801   1/1  ellkelakel......pgvtfvdlydl........................-------------------