[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF68874.1


[Show Plain Result]

## Summary of Sequence Search
   1::286
   1::286    1e-80 44.1% 0039319 00393191 1/1   like cupins                             
   3::253  1.9e-70 48.3% 0049672 00496721 1/1   like cupins                             
  57::214    3e-16 27.2% 0051192 00511921 1/1   like cupins                             
  11::218  4.1e-11 22.2% 0047686 00476861 1/1   like cupins                             
   1::286


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
00393191   1/1  mirlrlalllglathdglgvrvrrsf.pdpelrlfgpflvldefgv......dpgagfppHPHrgletvT
00496721   1/1  --mivlrlalergladggglkvrrlfsfadyydplldpfllldvlnddlvapga...gfppHPHrgletv
00511921   1/1  --------------------------------------------------------IvPtlPetgygYil
00476861   1/1  ----------mvllldlapdsprpvviragdlpplvepggglvrvlllfdp.......tggglsvglvrl


                         -         -         *         -         -         -         -:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
00393191   1/1  yvleGgeleHrDslGnkgvirpGdvqwmtAGsGivHsEmnls.....ggplhglqlWvnlPadlkglePr
00496721   1/1  TyvleGeleHrDslgnkgvirpGdvqwmtAGsGivHsEmnl....sedgplhglQlWvnlpa..kglePr
00511921   1/1  aglagellligggvrrvlvfvekpslglaagiirlapgegsglhrhrdaeevfyvleGegrltd.dgeki
00476861   1/1  ppG...ggfppppHrHpdaeellyvleGegrltlgdgggpeeevvlepGdvvyiPa..GvpHsf......


                         +         -         -         -         -         *         -:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
00393191   1/1  yqdlpaddiPvveldg..vlvrviagellgvdgpvkirtdlllldvtlppgasltlhlhagreeflyvle
00496721   1/1  yqqlaaedip..........vrviagsllgvdgpvtiltdallldvlleagasltlplpegrnaylyvle
00511921   1/1  rlkpGdvfllPag......ishdlanlgdtpglllwsldgslsalavplvelfdhatsisrklegvsldk
00476861   1/1  .rnlgd.plrvlvvfdppdfedllpdlgdlagellpapl..lpedllaallllpaeelldvlvkqdlivl


                         -         -         -         +         -         -         -:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
00393191   1/1  GevevngggeelvlgagdllvlpagvphslrnaadeparfllvggePldepvviygpfVmnskeeieqai
00496721   1/1  Gevtvnge.tleagdlavle.dgdaltleagedaevllldgeP---------------------------
00511921   1/1  iAea------------------------------------------------------------------
00476861   1/1  ldelqlle--------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GRFGQI----------------------------------------------------------------
00393191   1/1  edyqag----------------------------------------------------------------
00496721   1/1  ----------------------------------------------------------------------
00511921   1/1  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------