[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69088.1


[Show Plain Result]

## Summary of Sequence Search
   1::491
 240::486  4.9e-41 28.7% 0042280 00422802 2/2   p containing nucleoside triphosphate hy 
 257::475  5.9e-39 29.4% 0037958 00379582 2/2   p containing nucleoside triphosphate hy 
 268::480  4.5e-38 27.7% 0039041 00390412 2/2   p containing nucleoside triphosphate hy 
   4::259  1.9e-37 30.6% 0049080 00490801 1/2   p containing nucleoside triphosphate hy 
 261::480  2.2e-37 28.8% 0049080 00490802 2/2   p containing nucleoside triphosphate hy 
 259::475  2.6e-37 32.2% 0043607 00436072 2/2   p containing nucleoside triphosphate hy 
 261::480  3.8e-37 28.8% 0051025 00510252 2/2   p containing nucleoside triphosphate hy 
   4::260  4.5e-37 31.3% 0051025 00510251 1/2   p containing nucleoside triphosphate hy 
 261::475  1.2e-36 28.0% 0036790 00367902 2/2   p containing nucleoside triphosphate hy 
 258::475  1.3e-36 31.0% 0037898 00378982 2/2   p containing nucleoside triphosphate hy 
   4::239  1.4e-36 30.9% 0037958 00379581 1/2   p containing nucleoside triphosphate hy 
 255::467  1.4e-36 30.7% 0050044 00500442 2/2   p containing nucleoside triphosphate hy 
 255::467  1.9e-36 28.9% 0047589 00475892 2/2   p containing nucleoside triphosphate hy 
   4::244  1.4e-35 30.7% 0045860 00458601 1/2   p containing nucleoside triphosphate hy 
   4::221  1.5e-35 31.9% 0042280 00422801 1/2   p containing nucleoside triphosphate hy 
 258::475  1.6e-35 30.5% 0042070 00420702 2/2   p containing nucleoside triphosphate hy 
   4::236  2.5e-35 30.0% 0047589 00475891 1/2   p containing nucleoside triphosphate hy 
   1::225  3.1e-35 30.2% 0037898 00378981 1/2   p containing nucleoside triphosphate hy 
 261::475  3.8e-35 31.9% 0042557 00425572 2/2   p containing nucleoside triphosphate hy 
 261::475    7e-35 29.9% 0050943 00509432 2/2   p containing nucleoside triphosphate hy 
 263::475  1.4e-34 33.0% 0040410 00404102 2/2   p containing nucleoside triphosphate hy 
 256::467  1.7e-34 28.0% 0046697 00466972 2/2   p containing nucleoside triphosphate hy 
 261::467  2.8e-34 25.5% 0045860 00458602 2/2   p containing nucleoside triphosphate hy 
 258::486  2.9e-34 26.4% 0048220 00482202 2/2   p containing nucleoside triphosphate hy 
   4::225  3.1e-34 31.8% 0048220 00482201 1/2   p containing nucleoside triphosphate hy 
   4::225  5.7e-34 30.5% 0050044 00500441 1/2   p containing nucleoside triphosphate hy 
   2::225    1e-33 32.7% 0050274 00502741 1/2   p containing nucleoside triphosphate hy 
 225::472  1.2e-33 29.9% 0043651 00436512 2/2   p containing nucleoside triphosphate hy 
   1::225  1.4e-33 30.2% 0042070 00420701 1/2   p containing nucleoside triphosphate hy 
 243::480  2.2e-33 25.3% 0053059 00530592 2/2   p containing nucleoside triphosphate hy 
 249::467  2.5e-33 36.4% 0037230 00372302 2/2   p containing nucleoside triphosphate hy 
   4::225    3e-33 31.8% 0048226 00482261 1/2   p containing nucleoside triphosphate hy 
   4::225  3.3e-33 30.5% 0042557 00425571 1/2   p containing nucleoside triphosphate hy 
   5::234  8.3e-33 30.8% 0040410 00404101 1/2   p containing nucleoside triphosphate hy 
   4::238  1.4e-32 31.3% 0053059 00530591 1/2   p containing nucleoside triphosphate hy 
   4::235    2e-32 30.2% 0047599 00475991 1/2   p containing nucleoside triphosphate hy 
 247::467  2.2e-32 25.5% 0047599 00475992 2/2   p containing nucleoside triphosphate hy 
 251::467  2.4e-32 28.4% 0044086 00440862 2/2   p containing nucleoside triphosphate hy 
 259::486  2.5e-32 27.2% 0048226 00482262 2/2   p containing nucleoside triphosphate hy 
   1::227  4.3e-32 32.4% 0037230 00372301 1/2   p containing nucleoside triphosphate hy 
 268::475  4.4e-32 28.2% 0046693 00466932 2/2   p containing nucleoside triphosphate hy 
 252::463  6.2e-32 30.5% 0036121 00361212 2/2   p containing nucleoside triphosphate hy 
 259::467  1.7e-31 27.8% 0050274 00502742 2/2   p containing nucleoside triphosphate hy 
   4::222  1.8e-31 31.1% 0046697 00466971 1/2   p containing nucleoside triphosphate hy 
  10::221  4.8e-31 32.9% 0046693 00466931 1/2   p containing nucleoside triphosphate hy 
  10::217  9.7e-31 31.1% 0039041 00390411 1/2   p containing nucleoside triphosphate hy 
 251::486  1.2e-30 27.3% 0048852 00488522 2/2   p containing nucleoside triphosphate hy 
 259::464  1.2e-30 31.2% 0046945 00469452 2/2   p containing nucleoside triphosphate hy 
 250::475  1.7e-30 28.1% 0036748 00367482 2/2   p containing nucleoside triphosphate hy 
   4::221  5.8e-30 30.4% 0036790 00367901 1/2   p containing nucleoside triphosphate hy 
 269::486  3.8e-29 29.0% 0048545 00485452 2/2   p containing nucleoside triphosphate hy 
 240::484  1.9e-28 25.4% 0042496 00424962 2/2   p containing nucleoside triphosphate hy 
   1::225  2.1e-28 33.8% 0050943 00509431 1/2   p containing nucleoside triphosphate hy 
   4::209  2.3e-28 28.9% 0043607 00436071 1/2   p containing nucleoside triphosphate hy 
   1::232  4.6e-28 29.6% 0044086 00440861 1/2   p containing nucleoside triphosphate hy 
 258::486  3.3e-27 28.3% 0049825 00498252 2/2   p containing nucleoside triphosphate hy 
   4::223  3.4e-27 29.6% 0036121 00361211 1/2   p containing nucleoside triphosphate hy 
   4::225  3.9e-27 33.3% 0048852 00488521 1/2   p containing nucleoside triphosphate hy 
 242::481  4.7e-27 27.4% 0046869 00468692 2/2   p containing nucleoside triphosphate hy 
 255::476    7e-27 31.5% 0037960 00379602 2/2   p containing nucleoside triphosphate hy 
 268::493  1.5e-26 27.7% 0050337 00503372 2/2   p containing nucleoside triphosphate hy 
 286::447  1.7e-26 34.0% 0038144 00381442 2/2   p containing nucleoside triphosphate hy 
 263::465  5.2e-26 27.6% 0049537 00495372 2/2   p containing nucleoside triphosphate hy 
   3::223  9.8e-26 33.9% 0036748 00367481 1/2   p containing nucleoside triphosphate hy 
 263::470  1.7e-25 30.8% 0049611 00496112 2/2   p containing nucleoside triphosphate hy 
   4::222  1.9e-25 26.7% 0042496 00424961 1/2   p containing nucleoside triphosphate hy 
   2::205  2.2e-25 33.9% 0046945 00469451 1/2   p containing nucleoside triphosphate hy 
  10::233  3.9e-25 29.1% 0048545 00485451 1/2   p containing nucleoside triphosphate hy 
 259::471  4.4e-25 32.0% 0046479 00464792 2/2   p containing nucleoside triphosphate hy 
 276::460    7e-25 35.7% 0044893 00448932 2/2   p containing nucleoside triphosphate hy 
  29::182  7.3e-25 31.2% 0038144 00381441 1/2   p containing nucleoside triphosphate hy 
   1::228  2.7e-24 30.6% 0049825 00498251 1/2   p containing nucleoside triphosphate hy 
 232::478  1.7e-23 27.7% 0042214 00422142 2/2   p containing nucleoside triphosphate hy 
   4::225  9.5e-23 32.1% 0037960 00379601 1/2   p containing nucleoside triphosphate hy 
 251::485  9.7e-23 26.9% 0050061 00500612 2/2   p containing nucleoside triphosphate hy 
  12::224  4.6e-22 30.6% 0050337 00503371 1/2   p containing nucleoside triphosphate hy 
   3::226  6.9e-22 28.6% 0050061 00500611 1/2   p containing nucleoside triphosphate hy 
   4::226  1.2e-21 29.5% 0049537 00495371 1/2   p containing nucleoside triphosphate hy 
 284::481  1.6e-21 29.7% 0045731 00457312 2/2   p containing nucleoside triphosphate hy 
 278::467  2.4e-21 32.5% 0046860 00468602 2/2   p containing nucleoside triphosphate hy 
   1::225  2.6e-21 28.7% 0046869 00468691 1/2   p containing nucleoside triphosphate hy 
 272::466  4.3e-21 29.7% 0047841 00478412 2/2   arboxykinase-like                       
 257::473  8.6e-21 26.8% 0043798 00437982 2/2   p containing nucleoside triphosphate hy 
  23::246    9e-21 29.6% 0037996 00379961 1/2   p containing nucleoside triphosphate hy 
 281::461    1e-20 33.8% 0048593 00485932 2/2   p containing nucleoside triphosphate hy 
   3::203  1.6e-20 28.4% 0043651 00436511 1/2   p containing nucleoside triphosphate hy 
   6::233  1.6e-20 26.6% 0049611 00496111 1/2   p containing nucleoside triphosphate hy 
  19::210  1.9e-20 31.2% 0044893 00448931 1/2   p containing nucleoside triphosphate hy 
   3::226  2.6e-20 29.6% 0049503 00495031 1/2   p containing nucleoside triphosphate hy 
   4::230  2.9e-20 30.2% 0042214 00422141 1/2   p containing nucleoside triphosphate hy 
 287::491  5.7e-20 23.8% 0051289 00512892 2/2   p containing nucleoside triphosphate hy 
   4::226  7.6e-20 30.5% 0043798 00437981 1/2   p containing nucleoside triphosphate hy 
 280::433    1e-19 28.9% 0048047 00480472 2/2   p containing nucleoside triphosphate hy 
 275::465  1.3e-19 29.4% 0047537 00475372 2/2   p containing nucleoside triphosphate hy 
 254::486  1.4e-19 22.4% 0049503 00495032 2/2   p containing nucleoside triphosphate hy 
 273::437  2.9e-19 29.6% 0053253 00532532 2/2   arboxykinase-like                       
 272::450  3.5e-19 32.1% 0047552 00475522 2/2   arboxykinase-like                       
  23::224    5e-19 37.1% 0043794 00437941 1/2   p containing nucleoside triphosphate hy 
  30::234  9.7e-19 26.4% 0051289 00512891 1/2   p containing nucleoside triphosphate hy 
 284::480  1.2e-18 29.5% 0041412 00414122 2/2   p containing nucleoside triphosphate hy 
 260::482  1.4e-18 28.0% 0037163 00371632 2/2   p containing nucleoside triphosphate hy 
  24::226  1.5e-18 33.7% 0048593 00485931 1/2   p containing nucleoside triphosphate hy 
 254::390  4.2e-18 28.0% 0038720 00387202 2/2   p containing nucleoside triphosphate hy 
 262::491    5e-18 27.9% 0050374 00503742 2/2   p containing nucleoside triphosphate hy 
  18::218  5.4e-18 28.9% 0047537 00475371 1/2   p containing nucleoside triphosphate hy 
   1::223    6e-18 25.3% 0046479 00464791 1/2   p containing nucleoside triphosphate hy 
  23::167  7.8e-18 30.1% 0048047 00480471 1/2   p containing nucleoside triphosphate hy 
 284::478  1.5e-17 26.5% 0042605 00426052 2/2   p containing nucleoside triphosphate hy 
  27::237  3.1e-17 31.7% 0045731 00457311 1/2   p containing nucleoside triphosphate hy 
  21::226  3.4e-17 28.1% 0046860 00468601 1/2   p containing nucleoside triphosphate hy 
 258::492  3.8e-17 25.6% 0037996 00379962 2/2   p containing nucleoside triphosphate hy 
 286::490    4e-17 26.5% 0040588 00405882 2/2   p containing nucleoside triphosphate hy 
  27::210  4.6e-17 26.6% 0041412 00414121 1/2   p containing nucleoside triphosphate hy 
 270::461  4.9e-17 26.7% 0046276 00462762 2/2   p containing nucleoside triphosphate hy 
 284::474  2.4e-16 31.0% 0047797 00477972 2/2   p containing nucleoside triphosphate hy 
 268::486  2.6e-16 27.5% 0043440 00434402 2/2   p containing nucleoside triphosphate hy 
 284::437  4.7e-16 32.8% 0047538 00475382 2/2   p containing nucleoside triphosphate hy 
 255::490  1.7e-15 23.5% 0036850 00368502 2/2   p containing nucleoside triphosphate hy 
 254::464  2.2e-15 28.1% 0043794 00437942 2/2   p containing nucleoside triphosphate hy 
 285::479  2.4e-15 27.7% 0049343 00493432 2/2   p containing nucleoside triphosphate hy 
  15::200  3.3e-15 31.0% 0047841 00478411 1/2   arboxykinase-like                       
 285::474  4.8e-15 26.9% 0053350 00533502 2/2   p containing nucleoside triphosphate hy 
  24::200  6.5e-15 33.5% 0036857 00368571 1/2   p containing nucleoside triphosphate hy 
  27::194  7.8e-15 29.1% 0042605 00426051 1/2   p containing nucleoside triphosphate hy 
  17::220  8.3e-15 30.6% 0037163 00371631 1/2   p containing nucleoside triphosphate hy 
   5::198  8.9e-15 30.6% 0050374 00503741 1/2   p containing nucleoside triphosphate hy 
 255::465  9.4e-15 27.0% 0040419 00404192 2/2   p containing nucleoside triphosphate hy 
 264::485  1.3e-14 27.0% 0048957 00489572 2/2   p containing nucleoside triphosphate hy 
  13::200  1.4e-14 25.6% 0036850 00368501 1/2   p containing nucleoside triphosphate hy 
  27::171    2e-14 29.9% 0047538 00475381 1/2   p containing nucleoside triphosphate hy 
 282::483  2.2e-14 26.7% 0048702 00487022 2/2   p containing nucleoside triphosphate hy 
  15::184  3.1e-14 35.6% 0047552 00475521 1/2   arboxykinase-like                       
  19::200  6.2e-14 40.4% 0039270 00392701 1/2   p containing nucleoside triphosphate hy 
 272::461  6.8e-14 27.4% 0047844 00478442 2/2   arboxykinase-like                       
 270::491  1.2e-13 29.0% 0039270 00392702 2/2   p containing nucleoside triphosphate hy 
 285::451  1.4e-13 25.3% 0051551 00515512 2/2   p containing nucleoside triphosphate hy 
 236::467  1.6e-13 24.2% 0036857 00368572 2/2   p containing nucleoside triphosphate hy 
 273::486  1.6e-13 24.6% 0051325 00513252 2/2   p containing nucleoside triphosphate hy 
 263::459  1.9e-13 22.7% 0035641 00356412 2/2   p containing nucleoside triphosphate hy 
 285::454  2.4e-13 25.2% 0051553 00515532 2/2   p containing nucleoside triphosphate hy 
  23::225  2.9e-13 30.0% 0049073 00490731 1/2   p containing nucleoside triphosphate hy 
  17::200  3.2e-13 35.3% 0040678 00406781 1/2   p containing nucleoside triphosphate hy 
 281::459    4e-13 26.1% 0045157 00451572 2/2   p containing nucleoside triphosphate hy 
  16::183  5.9e-13 29.7% 0053253 00532531 1/2   arboxykinase-like                       
  24::193  7.6e-13 26.7% 0045157 00451571 1/2   p containing nucleoside triphosphate hy 
  28::188  8.1e-13 27.1% 0051553 00515531 1/2   p containing nucleoside triphosphate hy 
   5::256    1e-12 23.6% 0048957 00489571 1/2   p containing nucleoside triphosphate hy 
 248::473  1.4e-12 25.0% 0040678 00406782 2/2   p containing nucleoside triphosphate hy 
 283::467  2.1e-12 34.3% 0046441 00464412 2/2   p containing nucleoside triphosphate hy 
  14::183  2.3e-12 31.5% 0046276 00462761 1/2   p containing nucleoside triphosphate hy 
  27::210  2.8e-12 27.8% 0047797 00477971 1/2   p containing nucleoside triphosphate hy 
  31::192  5.7e-12 32.6% 0048702 00487021 1/2   p containing nucleoside triphosphate hy 
   1::125    9e-12 26.1% 0038720 00387201 1/2   p containing nucleoside triphosphate hy 
 278::481    1e-11 25.2% 0049073 00490732 2/2   p containing nucleoside triphosphate hy 
  23::236  1.8e-11 32.7% 0043218 00432181 1/2   p containing nucleoside triphosphate hy 
 285::465  1.9e-11 29.5% 0053247 00532472 2/2   p containing nucleoside triphosphate hy 
  28::181  2.7e-11 32.8% 0053247 00532471 1/2   p containing nucleoside triphosphate hy 
 285::476  2.9e-11 28.8% 0049657 00496572 2/2   p containing nucleoside triphosphate hy 
 283::467  3.8e-11 23.2% 0043986 00439862 2/2   p containing nucleoside triphosphate hy 
 270::492  4.3e-11 21.3% 0037926 00379262 2/2   p containing nucleoside triphosphate hy 
 280::457  4.3e-11 22.9% 0047073 00470732 2/2   p containing nucleoside triphosphate hy 
  22::200  5.2e-11 32.5% 0043790 00437901 1/2   p containing nucleoside triphosphate hy 
 280::442  6.3e-11 29.8% 0043218 00432182 2/2   p containing nucleoside triphosphate hy 
  28::185  6.4e-11 24.7% 0051551 00515511 1/2   p containing nucleoside triphosphate hy 
  23::200  6.6e-11 33.6% 0036729 00367291 1/2   p containing nucleoside triphosphate hy 
  23::200  7.3e-11 37.2% 0042094 00420941 1/2   p containing nucleoside triphosphate hy 
 285::458  1.2e-10 24.7% 0048410 00484102 2/2   p containing nucleoside triphosphate hy 
  23::204  1.4e-10 33.9% 0040419 00404191 1/2   p containing nucleoside triphosphate hy 
  28::198  1.4e-10 24.1% 0037926 00379261 1/2   p containing nucleoside triphosphate hy 
  28::188  3.2e-10 24.5% 0048410 00484101 1/2   p containing nucleoside triphosphate hy 
  33::200  4.2e-10 22.3% 0047701 00477011 1/2   p containing nucleoside triphosphate hy 
 258::473  4.5e-10 29.1% 0038674 00386742 2/2   p containing nucleoside triphosphate hy 
  23::178  4.8e-10 34.4% 0047073 00470731 1/2   p containing nucleoside triphosphate hy 
  33::240  5.3e-10 24.4% 0053350 00533501 1/2   p containing nucleoside triphosphate hy 
  22::235  5.6e-10 26.9% 0051769 00517691 1/2   p containing nucleoside triphosphate hy 
 276::460  5.6e-10 22.2% 0047701 00477012 2/2   p containing nucleoside triphosphate hy 
  29::197  6.5e-10 30.1% 0049657 00496571 1/2   p containing nucleoside triphosphate hy 
  27::198  1.5e-09 23.7% 0046441 00464411 1/2   p containing nucleoside triphosphate hy 
 246::463  1.5e-09 22.6% 0043790 00437902 2/2   p containing nucleoside triphosphate hy 
 285::448  2.6e-09 29.1% 0049919 00499192 2/2   p containing nucleoside triphosphate hy 
 285::474  3.1e-09 25.6% 0051958 00519582 2/2   p containing nucleoside triphosphate hy 
  10::191  3.3e-09 26.7% 0043440 00434401 1/2   p containing nucleoside triphosphate hy 
 283::465  5.9e-09 25.0% 0049853 00498532 2/2   p containing nucleoside triphosphate hy 
  29::176  6.5e-09 25.0% 0040588 00405881 1/2   p containing nucleoside triphosphate hy 
 287::485  6.5e-09 21.5% 0051376 00513762 2/2   p containing nucleoside triphosphate hy 
 283::460  7.3e-09 25.7% 0051056 00510562 2/2   p containing nucleoside triphosphate hy 
   7::200    8e-09 29.4% 0043986 00439861 1/2   p containing nucleoside triphosphate hy 
 284::478  9.9e-09 21.4% 0049881 00498812 2/2   p containing nucleoside triphosphate hy 
  14::197  1.1e-08 29.6% 0047844 00478441 1/2   arboxykinase-like                       
  23::200  1.1e-08 35.3% 0043792 00437921 1/2   p containing nucleoside triphosphate hy 
  23::199  1.3e-08 25.8% 0048025 00480251 1/2   p containing nucleoside triphosphate hy 
 287::476  1.4e-08 22.0% 0048044 00480442 2/2   p containing nucleoside triphosphate hy 
  16::223  1.5e-08 28.2% 0051056 00510561 1/2   p containing nucleoside triphosphate hy 
  23::200  2.3e-08 33.6% 0052155 00521551 1/2   p containing nucleoside triphosphate hy 
 279::428  2.3e-08 27.7% 0051769 00517692 2/2   p containing nucleoside triphosphate hy 
 248::473  2.5e-08 24.8% 0052155 00521552 2/2   p containing nucleoside triphosphate hy 
  29::167  3.7e-08 27.9% 0049919 00499191 1/2   p containing nucleoside triphosphate hy 
  33::200  3.9e-08 31.0% 0051376 00513761 1/2   p containing nucleoside triphosphate hy 
  23::200  4.1e-08 38.2% 0038674 00386741 1/2   p containing nucleoside triphosphate hy 
 245::463  4.3e-08 22.1% 0043792 00437922 2/2   p containing nucleoside triphosphate hy 
   6::193  5.2e-08 23.8% 0035641 00356411 1/2   p containing nucleoside triphosphate hy 
  33::254  5.3e-08 29.9% 0039472 00394721 1/2   p containing nucleoside triphosphate hy 
 270::311  7.8e-08 35.7% 0041032 00410322 2/2   p containing nucleoside triphosphate hy 
  16::224  8.8e-08 27.1% 0051325 00513251 1/2   p containing nucleoside triphosphate hy 
  16::230  1.2e-07 28.7% 0046895 00468951 1/2   p containing nucleoside triphosphate hy 
  23::232  1.2e-07 21.3% 0049933 00499331 1/2   p containing nucleoside triphosphate hy 
 256::473  1.3e-07 22.1% 0036729 00367292 2/2   p containing nucleoside triphosphate hy 
 282::491  1.3e-07 21.1% 0047291 00472912 2/2   p containing nucleoside triphosphate hy 
 268::455  1.6e-07 26.3% 0050867 00508672 2/2   p containing nucleoside triphosphate hy 
 270::485    2e-07 18.0% 0052726 00527262 2/2   p containing nucleoside triphosphate hy 
  13::209  2.1e-07 27.0% 0040237 00402371 1/2   p containing nucleoside triphosphate hy 
  29::232  3.2e-07 18.7% 0049606 00496061 1/2   p containing nucleoside triphosphate hy 
 279::445  3.5e-07 32.1% 0040984 00409842 2/2   p containing nucleoside triphosphate hy 
 283::465  3.7e-07 25.9% 0046895 00468952 2/2   p containing nucleoside triphosphate hy 
  17::235    4e-07 24.5% 0041053 00410531 1/2   p containing nucleoside triphosphate hy 
 277::491    4e-07 23.4% 0042094 00420942 2/2   p containing nucleoside triphosphate hy 
 285::477  4.4e-07 20.2% 0048963 00489632 2/2   p containing nucleoside triphosphate hy 
  29::245  5.4e-07 21.6% 0048272 00482721 1/2   p containing nucleoside triphosphate hy 
  29::235  5.6e-07 26.6% 0048963 00489631 1/2   p containing nucleoside triphosphate hy 
  22::236  5.7e-07 30.7% 0040984 00409841 1/2   p containing nucleoside triphosphate hy 
  28::183  6.5e-07 26.8% 0049343 00493431 1/2   p containing nucleoside triphosphate hy 
  26::211  6.7e-07 27.0% 0048255 00482551 1/2   p containing nucleoside triphosphate hy 
 241::477  8.5e-07 21.1% 0040237 00402372 2/2   p containing nucleoside triphosphate hy 
 280::474  8.8e-07 21.3% 0049933 00499332 2/2   p containing nucleoside triphosphate hy 
   9::178  9.2e-07 29.3% 0041617 00416171 1/2   p containing nucleoside triphosphate hy 
  25::237  1.1e-06 24.8% 0047291 00472911 1/2   p containing nucleoside triphosphate hy 
  29::183  1.4e-06 24.5% 0049881 00498811 1/2   p containing nucleoside triphosphate hy 
 285::481  2.3e-06 20.4% 0040315 00403152 2/2   p containing nucleoside triphosphate hy 
  15::223  2.6e-06 28.6% 0049853 00498531 1/2   p containing nucleoside triphosphate hy 
  23::236  2.8e-06 20.7% 0053315 00533151 1/2   p containing nucleoside triphosphate hy 
  25::233  3.4e-06 32.8% 0040121 00401211 1/2   p containing nucleoside triphosphate hy 
 273::463  3.5e-06 23.8% 0039472 00394722 2/2   p containing nucleoside triphosphate hy 
 274::466  3.6e-06 20.7% 0041053 00410532 2/2   p containing nucleoside triphosphate hy 
 278::465  4.2e-06 22.9% 0048025 00480252 2/2   p containing nucleoside triphosphate hy 
  13::200  4.5e-06 31.1% 0044438 00444381 1/2   p containing nucleoside triphosphate hy 
 264::478  4.9e-06 18.9% 0048266 00482662 2/2   p containing nucleoside triphosphate hy 
  21::181  5.3e-06 35.7% 0048266 00482661 1/2   p containing nucleoside triphosphate hy 
  31::178  5.6e-06 33.7% 0043012 00430121 1/2   p containing nucleoside triphosphate hy 
  25::233  1.1e-05 20.9% 0047839 00478391 1/2   p containing nucleoside triphosphate hy 
 282::428  1.1e-05 33.3% 0040121 00401212 2/2   p containing nucleoside triphosphate hy 
  30::181  1.3e-05 24.6% 0048044 00480441 1/2   p containing nucleoside triphosphate hy 
 285::448  1.4e-05 26.6% 0046162 00461622 2/2   p containing nucleoside triphosphate hy 
 243::490  1.6e-05 20.2% 0044438 00444382 2/2   p containing nucleoside triphosphate hy 
 283::433  1.6e-05 26.7% 0051535 00515352 2/2   p containing nucleoside triphosphate hy 
 283::488  1.9e-05 17.3% 0048255 00482552 2/2   p containing nucleoside triphosphate hy 
  21::203    2e-05 24.2% 0052726 00527261 1/2   p containing nucleoside triphosphate hy 
 246::428    2e-05 28.7% 0041830 00418302 2/2   p containing nucleoside triphosphate hy 
  29::240  2.4e-05 21.3% 0051604 00516041 1/2   p containing nucleoside triphosphate hy 
 285::450  2.6e-05 25.4% 0047607 00476072 2/2   p containing nucleoside triphosphate hy 
  29::232  3.2e-05 22.3% 0047808 00478081 1/2   p containing nucleoside triphosphate hy 
  24::200  4.8e-05 30.1% 0047394 00473941 1/2   p containing nucleoside triphosphate hy 
 237::489  6.9e-05 21.1% 0043012 00430122 2/2   p containing nucleoside triphosphate hy 
  24::234  0.00011 19.3% 0048939 00489391 1/2   p containing nucleoside triphosphate hy 
 284::449  0.00011 23.9% 0048706 00487062 2/2   p containing nucleoside triphosphate hy 
 266::428  0.00015 33.3% 0041617 00416172 2/2   p containing nucleoside triphosphate hy 
 271::311  0.00016 34.1% 0037862 00378622 2/2   p containing nucleoside triphosphate hy 
  29::233  0.00018 25.0% 0047607 00476071 1/2   p containing nucleoside triphosphate hy 
  24::189  0.00019 30.3% 0050867 00508671 1/2   p containing nucleoside triphosphate hy 
  29::237  0.00022 18.9% 0045785 00457851 1/2   p containing nucleoside triphosphate hy 
 280::306  0.00023 37.0% 0053315 00533152 2/2   p containing nucleoside triphosphate hy 
 257::474  0.00024 27.1% 0047394 00473942 2/2   p containing nucleoside triphosphate hy 
  30::161  0.00026 32.5% 0047665 00476651 1/2   p containing nucleoside triphosphate hy 
 286::430  0.00026 23.5% 0049606 00496062 2/2   p containing nucleoside triphosphate hy 
 285::430  0.00032 22.7% 0045785 00457852 2/2   p containing nucleoside triphosphate hy 
 283::448  0.00043 24.5% 0048939 00489392 2/2   p containing nucleoside triphosphate hy 
  29::55   0.00053 51.9% 0047772 00477721 1/2   p containing nucleoside triphosphate hy 
 166::338  0.00062 25.5% 0049577 00495772 2/2   p containing nucleoside triphosphate hy 
  28::200  0.00086 34.6% 0046258 00462581 1/2   p containing nucleoside triphosphate hy 
  29::54     0.001 46.2% 0047813 00478131 1/2   p containing nucleoside triphosphate hy 
  28::54    0.0012 44.4% 0045970 00459701 1/2   p containing nucleoside triphosphate hy 
 286::448   0.0012 24.5% 0047808 00478082 2/2   p containing nucleoside triphosphate hy 
  26::55    0.0015 51.7% 0051535 00515351 1/2   p containing nucleoside triphosphate hy 
  29::53    0.0018 52.0% 0047756 00477561 1/2   p containing nucleoside triphosphate hy 
  33::188   0.0018 23.8% 0048706 00487061 1/2   p containing nucleoside triphosphate hy 
 280::306   0.0021 44.4% 0051138 00511382 2/2   p containing nucleoside triphosphate hy 
 273::308   0.0024 38.9% 0047127 00471272 2/2   p containing nucleoside triphosphate hy 
  10::161   0.0026 38.0% 0049757 00497571 1/2   p containing nucleoside triphosphate hy 
 282::474   0.0026 22.5% 0047839 00478392 2/2   p containing nucleoside triphosphate hy 
  23::59    0.0027 48.6% 0049577 00495771 1/2   p containing nucleoside triphosphate hy 
  29::55    0.0028 51.9% 0049398 00493981 1/2   p containing nucleoside triphosphate hy 
  27::53    0.0029 44.4% 0051206 00512061 1/2   p containing nucleoside triphosphate hy 
  25::198   0.0032 32.3% 0041830 00418301 1/2   p containing nucleoside triphosphate hy 
  13::200   0.0034 27.2% 0047420 00474201 1/2   p containing nucleoside triphosphate hy 
  33::197   0.0036 32.1% 0046916 00469161 1/2   p containing nucleoside triphosphate hy 
  29::209   0.0038 26.2% 0048050 00480501 1/2   p containing nucleoside triphosphate hy 
  29::234   0.0039 19.2% 0045788 00457881 1/2   p containing nucleoside triphosphate hy 
  13::55    0.0041 30.2% 0041032 00410321 1/2   p containing nucleoside triphosphate hy 
  28::55    0.0064 50.0% 0046162 00461621 1/2   p containing nucleoside triphosphate hy 
 288::477   0.0071 24.5% 0050989 00509892 2/2   p containing nucleoside triphosphate hy 
 286::311    0.008 42.3% 0049317 00493172 2/2   p containing nucleoside triphosphate hy 
 286::306   0.0084 42.9% 0047813 00478132 2/2   p containing nucleoside triphosphate hy 
 284::314   0.0085 30.0% 0051206 00512062 2/2   p containing nucleoside triphosphate hy 
 284::306   0.0092 34.8% 0047756 00477562 2/2   p containing nucleoside triphosphate hy 
 285::465   0.0094 21.2% 0045788 00457882 2/2   p containing nucleoside triphosphate hy 
  33::59     0.011 40.7% 0042008 00420081 1/2   p containing nucleoside triphosphate hy 
 271::311    0.013 29.3% 0038732 00387322 2/2   p containing nucleoside triphosphate hy 
 282::308    0.013 33.3% 0042008 00420082 2/2   p containing nucleoside triphosphate hy 
  26::55     0.014 50.0% 0049190 00491901 1/2   p containing nucleoside triphosphate hy 
  28::168    0.014 30.2% 0051958 00519581 1/2   p containing nucleoside triphosphate hy 
  28::53     0.015 52.0% 0047933 00479331 1/2   p containing nucleoside triphosphate hy 
 286::442     0.02 22.3% 0048272 00482722 2/2   p containing nucleoside triphosphate hy 
 282::311    0.022 30.0% 0044482 00444822 2/2   p containing nucleoside triphosphate hy 
 286::487    0.022 22.5% 0048050 00480502 2/2   p containing nucleoside triphosphate hy 
 285::306    0.025 31.8% 0049398 00493982 2/2   p containing nucleoside triphosphate hy 
 291::428    0.025 21.4% 0046916 00469162 2/2   p containing nucleoside triphosphate hy 
  14::231    0.031 29.9% 0037862 00378621 1/2   p containing nucleoside triphosphate hy 
  28::55     0.034 42.9% 0049317 00493171 1/2   p containing nucleoside triphosphate hy 
 286::306    0.036 33.3% 0047772 00477722 2/2   p containing nucleoside triphosphate hy 
  24::55     0.037 37.5% 0044125 00441251 1/2   p containing nucleoside triphosphate hy 
 285::306    0.046 40.9% 0051604 00516042 2/2   p containing nucleoside triphosphate hy 
 247::490    0.049 19.2% 0047665 00476652 2/2   p containing nucleoside triphosphate hy 
 285::306    0.059 36.4% 0049190 00491902 2/2   p containing nucleoside triphosphate hy 
 287::364    0.071 19.5% 0051851 00518512 2/2   p containing nucleoside triphosphate hy 
  30::55     0.074 46.2% 0048692 00486921 1/2   p containing nucleoside triphosphate hy 
 252::479     0.11 19.4% 0049757 00497572 2/2   p containing nucleoside triphosphate hy 
 287::430     0.15 21.9% 0048692 00486922 2/2   p containing nucleoside triphosphate hy 
 275::308     0.17 29.4% 0044125 00441252 2/2   p containing nucleoside triphosphate hy 
  31::54       0.2 45.8% 0050989 00509891 1/2   p containing nucleoside triphosphate hy 
 246::490     0.21 18.0% 0047420 00474202 2/2   p containing nucleoside triphosphate hy 
  30::55      0.23 46.2% 0051851 00518511 1/2   p containing nucleoside triphosphate hy 
 257::306     0.32 24.5% 0046258 00462582 2/2   p containing nucleoside triphosphate hy 
 286::306     0.35 38.1% 0045970 00459702 2/2   p containing nucleoside triphosphate hy 
  23::50      0.37 46.4% 0051138 00511381 1/2   p containing nucleoside triphosphate hy 
  33::51      0.79 57.9% 0047127 00471271 1/2   p containing nucleoside triphosphate hy 
  28::52      0.84 36.0% 0040315 00403151 1/2   p containing nucleoside triphosphate hy 
  14::52      0.95 28.2% 0038732 00387321 1/2   p containing nucleoside triphosphate hy 
 286::306     0.97 35.0% 0047933 00479332 2/2   p containing nucleoside triphosphate hy 
  25::235        1 25.8% 0044482 00444821 1/2   p containing nucleoside triphosphate hy 
   1::491


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGERQCRFTRITRL
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00490801   1/2  ---llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeival
00490802   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ---lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeiv
00367902   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00379581   1/2  ---lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgld
00500442   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00458601   1/2  ---lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdit
00422801   1/2  ---llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllk
00420702   2/2  ----------------------------------------------------------------------
00475891   1/2  ---lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg
00378981   1/2  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00425572   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00482201   1/2  ---llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00500441   1/2  ---lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldg
00502741   1/2  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00436512   2/2  ----------------------------------------------------------------------
00420701   1/2  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00530592   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00482261   1/2  ---lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00425571   1/2  ---lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllal
00404101   1/2  ----elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltal
00530591   1/2  ---llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00475991   1/2  ---lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt
00475992   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00372301   1/2  yvlPllsdgmpllelenlrkpy..ggllvlndvsl.pgeivaltGpnGaGKSTllrllaglllpasggil
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00466971   1/2  ---llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00466931   1/2  ---------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkd
00390411   1/2  ---------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsd
00488522   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00367901   1/2  ---lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidli
00485452   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509431   1/2  Mlelknlslsnfr.......vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragg
00436071   1/2  ---pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldll
00440861   1/2  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00498252   2/2  ----------------------------------------------------------------------
00361211   1/2  ---plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsv
00488521   1/2  ---lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsG
00468692   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00367481   1/2  --yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllp
00496112   2/2  ----------------------------------------------------------------------
00424961   1/2  ---lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliagll
00469451   1/2  -allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkd
00485451   1/2  ---------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00464792   2/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00498251   1/2  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00422142   2/2  ----------------------------------------------------------------------
00379601   1/2  ---llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvld
00500612   2/2  ----------------------------------------------------------------------
00503371   1/2  -----------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirl
00500611   1/2  --pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsge
00495371   1/2  ---esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkpevlvd
00457312   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00468691   1/2  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00478412   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------slalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsd
00485932   2/2  ----------------------------------------------------------------------
00436511   1/2  --ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikk
00496111   1/2  -----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglel
00448931   1/2  ------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl
00495031   1/2  --lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplg
00422141   1/2  ---dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielif
00512892   2/2  ----------------------------------------------------------------------
00437981   1/2  ---lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilld
00480472   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------slalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidas
00512891   1/2  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv...
00414122   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00485931   1/2  -----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
00387202   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00475371   1/2  -----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrp
00464791   1/2  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00480471   1/2  ----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgei
00426052   2/2  ----------------------------------------------------------------------
00457311   1/2  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00468601   1/2  --------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra
00379962   2/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00414121   1/2  --------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeili
00462762   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00478411   1/2  --------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvr
00533502   2/2  ----------------------------------------------------------------------
00368571   1/2  -----------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlg
00426051   1/2  --------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdl
00371631   1/2  ----------------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygpls
00503741   1/2  ----fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLak
00404192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00368501   1/2  ------------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGp
00475381   1/2  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlav.
00487022   2/2  ----------------------------------------------------------------------
00475521   1/2  --------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlvdl
00392701   1/2  ------------------ledlslgirpgknvlLvGppGvGKTtlaralagll.......gapfgrvda.
00478442   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpy
00406781   1/2  ----------------lllkdlslgippgknvllvGppGtGKTtlakalagel.......gvpfvrisa.
00451572   2/2  ----------------------------------------------------------------------
00532531   1/2  ---------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinle
00451571   1/2  -----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddllre
00515531   1/2  ---------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieid
00489571   1/2  ----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..............
00406782   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00462761   1/2  -------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgdd
00477971   1/2  --------------------------hkgelvvlvGPsGaGKsTLlnaLlgllp.tsgvisvsgttrppr
00487021   1/2  ------------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddl
00387201   1/2  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00490732   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlg
00532472   2/2  ----------------------------------------------------------------------
00532471   1/2  ---------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvg
00496572   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00437901   1/2  ---------------------lslgirpgrillLyGppGvGKTtlakalakel.......gapvieidas
00432182   2/2  ----------------------------------------------------------------------
00515511   1/2  ---------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieid
00367291   1/2  ----------------------slglrpgrnvllyGppGtGKTtlaralanel.......gapfirvda.
00420941   1/2  ----------------------slgirpgkgvllyGppGtGKTtlakalagel.......gapfiridg.
00484102   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------slgikpgeivllyGppGtGKTtlakalanelkkr.ggrvlyvsa....
00379261   1/2  ---------------------------drllleelrpvllddviGqeeakealsealrlplkrlelferl
00484101   1/2  ---------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrl
00477011   1/2  --------------------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKS
00386742   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTl
00533501   1/2  --------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldg
00517691   1/2  ---------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg......
00477012   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------GkgelivllGpsGsGKsTlarlLagll.....ggsvldtgep
00464411   1/2  --------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsg
00437902   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00434401   1/2  ---------sksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr
00498532   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgv
00513762   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00439861   1/2  ------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlakn..ggkvlyisl
00498812   2/2  ----------------------------------------------------------------------
00478441   1/2  -------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll
00437921   1/2  ----------------------llalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldas
00480251   1/2  ----------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDp
00480442   2/2  ----------------------------------------------------------------------
00510561   1/2  ---------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDll.lgiGgl
00521551   1/2  ----------------------slglrpgkgvlLvGppGtGKTtlaralagll.......gapfvrlsas
00517692   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd........
00513761   1/2  --------------------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDpa
00386741   1/2  ----------------------llgirpgehllLvGppGtGKTtlaralagel.......gapfvrlda.
00437922   2/2  ----------------------------------------------------------------------
00356411   1/2  -----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgv
00394721   1/2  --------------------------------lLvGppGvGKTtlakalakelaagsgpilldgvpvvrl
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  ---------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..
00468951   1/2  ---------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDll.lgi
00499331   1/2  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllr
00367292   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00402371   1/2  ------------qeealeallealrrrpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrl
00496061   1/2  ----------------------------gklivltGppGsGKtTlaklLaerl....glpvistddllre
00409842   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------gelknlslelkkglkillvGlngvGKTtllkrlaggefv..dygptigvnfktv
00420942   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------kgkiigltGpsGsGKsTlarlLae.l............glpv
00489631   1/2  ----------------------------MkgklillvGppGsGKtTlaraLaell.......glpf...i
00409841   1/2  ---------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilg
00493431   1/2  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrepr
00482551   1/2  -------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaa
00402372   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00416171   1/2  --------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr.............
00472911   1/2  ------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglag
00498811   1/2  ----------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddlt
00403152   2/2  ----------------------------------------------------------------------
00498531   1/2  --------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDal.lgiGglp
00533151   1/2  ----------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddllr
00401211   1/2  ------------------------elkrglnvgivGhvgaGKSTLlnaLlgll.................
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00444381   1/2  ------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairr
00482662   2/2  ----------------------------------------------------------------------
00482661   1/2  --------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqya
00430121   1/2  ------------------------------iPvsklleddrplleklrpvlfddvvgqeeakeallealr
00478391   1/2  ------------------------msikkgklilltGppGsGKtTlaralaerl............glpv
00401212   2/2  ----------------------------------------------------------------------
00480441   1/2  -----------------------------rlivllGpsGaGKsTlaklLaellpglivisvgdttr.epr
00461622   2/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00527261   1/2  --------------------npfilgpkvdledfigreeelkeleealpkivlltGprGsGKTtllkala
00418302   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------mlkgklillvGppGsGKtTlaralaeelglpfvvidaddl..
00476072   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------gkvivltGppGsGKtTlarlLaellkplgg..gvvvidtddl
00473941   1/2  -----------------------lrgepgehvlLvGppGtGKTtlaralagllga...............
00430122   2/2  ----------------------------------------------------------------------
00489391   1/2  -----------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllr.
00487062   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------kgkiigltGpsGsGKsTlaklLae.l....glpvidtddltr
00508671   1/2  -----------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrL....
00457851   1/2  ----------------------------PkgklivltGppGsGKtTlakaLaerl....glpvistddll
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00476651   1/2  -----------------------------yeplveklrpvllddlvgqeeakeallealaggrpprpvll
00496062   2/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------kpklilltGppGsGKttlaraLaeelg---------------
00495772   2/2  ----------------------------------------------------------------------
00462581   1/2  ---------------------------edleslllnplvkfedivpkvlddleealealaeaklpppkgv
00478131   1/2  ----------------------------kgkvivltGppGsGKtTlarlLaell----------------
00459701   1/2  ---------------------------MpkvillvGppGsGKTTlakaLakrlg----------------
00478082   2/2  ----------------------------------------------------------------------
00515351   1/2  -------------------------mn.gklivltGppGsGKtTlaraLaerlgl---------------
00477561   1/2  ----------------------------kkpkvillvGppGsGKtTlaraLak-----------------
00487061   1/2  --------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvv
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  ---------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvl
00478392   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------lldilkgktvalvGpsGvGKStLlNaLlgellattge-----------
00493981   1/2  ----------------------------kpklilltGppGsGKttlaraLaeelg---------------
00512061   1/2  --------------------------kkkkgklivltGppGsGKtTlakaLae-----------------
00418301   1/2  ------------------------girpgknvlLvGppGtGKTtlaralakll.......grpfirvdas
00474201   1/2  ------------deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGK
00469161   1/2  --------------------------------llIvieGppGsGKsTlaklLaerlgltglsv..lltre
00480501   1/2  ----------------------------MgklillvGppGsGKtTlaralaellg...gvvvidgddlrr
00457881   1/2  ----------------------------mgklivltGppGsGKtTlaklLaerl.......glpvidtdd
00410321   1/2  ------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp---------------
00461621   1/2  ---------------------------mkgmiialtGppGsGKsTlaklLaerlg---------------
00509892   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00420081   1/2  --------------------------------smkkglrIaleGpsGvGKTTlaklLar-----------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  -------------------------lmkgkiilltGppGsGKttlakaLaeelgl---------------
00519581   1/2  ---------------------------kpkvilltGppGvGKttlarlLakll............glpli
00479331   1/2  ---------------------------ap.kliltGppGsGKttlakaLaeel-----------------
00482722   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00378621   1/2  -------------glklllrrlslllkkglkvllvGlpgvGKstllnrla....................
00493171   1/2  ---------------------------mgklivllGpsGaGKsTlaklLaeklgl---------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  -----------------------kgipkknclllyGPpgtGKstlakalagllgg---------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  -----------------------------mlivltGppGsGKtTlakaLaerlgl---------------
00497572   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ------------------------------pkvigitGpsGsGKTTlanaLarl----------------
00474202   2/2  ----------------------------------------------------------------------
00518511   1/2  -----------------------------klIvleGpsGsGKsTlaklLaeklgl---------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------llllkpgglvlitGPtgsGKsttLlral--------------------
00471271   1/2  --------------------------------prailelesliksllekll-------------------
00403151   1/2  ---------------------------kglkivlvGdsgvGKTtLlnrllgd------------------
00387321   1/2  -------------glkglllrlklelkkllkillvGlpgvGKTtllnrllgd------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  ------------------------elkkllkvllvGlpgvGKttlln.......................


                         -         -         *         -         -         -         -:140
query           SFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLAQQFGISALLDRRFKYLSTGE
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00490801   1/2  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00490802   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  alvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00367902   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00379581   1/2  italslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellel
00500442   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00458601   1/2  glspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllll
00422801   1/2  llagllkptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeara
00420702   2/2  ----------------------------------------------------------------------
00475891   1/2  kdilglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalralllllllgletlldrlv
00378981   1/2  slaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellglddlldrlvgeL
00425572   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00482201   1/2  lglslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlp
00500441   1/2  kdildlsl..lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgledlldrlvs
00502741   1/2  slaelrgigyvfqqlallpsltvlenlalgll.llglskaeaaaraaellellgledlldrlpseLSgGq
00436512   2/2  ----------------------------------------------------------------------
00420701   1/2  llslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellglddlldrlvge
00530592   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00482261   1/2  dlslaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlp
00425571   1/2  sl..lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellglddlldrlvgeLSgGq
00404101   1/2  slaelrrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgldelldrlvgeLSgGq
00530591   1/2  lkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalrall
00475991   1/2  sGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllll
00475992   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00372301   1/2  vdgedlrigyvfq............................................llervgledlldr
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00466971   1/2  dilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllglet
00466931   1/2  ilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellalll
00390411   1/2  lirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnll
00488522   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00367901   1/2  lkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfp
00485452   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509431   1/2  lsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrl
00436071   1/2  a.....lrrgigyvfqdp.alfpgltvlenlalgllllgll.ealaralellellglgdl.drlvseLSg
00440861   1/2  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00498252   2/2  ----------------------------------------------------------------------
00361211   1/2  lldgleisalslaerlragigyvfqdlalfpeltvlenlalg.............rarellerlglail.
00488521   1/2  ei......................................ggkvlyvdqeeslfpltvlenlalggedve
00468692   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00367481   1/2  asggilvpgedalll............................................rvdeiltrvgl
00496112   2/2  ----------------------------------------------------------------------
00424961   1/2  dpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfrdegadvlllad
00469451   1/2  vlylsleesleqlrrrigyvfqdp...alfp......................aeellelvgledlldrl
00485451   1/2  vlvigldifrlsarelrkrig..vfqdpa.llphltvpenldlglll.....eilervlellelvgldvv
00464792   2/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00381441   1/2  gevdgvdltflsreeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellellg
00498251   1/2  Lalrllagllkpgggvvyidgeesldllrarrlgvvlqell...........lfpeltveenl.......
00422142   2/2  ----------------------------------------------------------------------
00379601   1/2  llsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltl
00500612   2/2  ----------------------------------------------------------------------
00503371   1/2  dgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslk
00500611   1/2  illggkvl.yisleeslrrrrigmvfqelgldpdltv.................arerviellelvglle
00495371   1/2  gldltglsparggiglvfqteallpp.ltvrenlealgldlrglld..........rerviellelvgle
00457312   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00468691   1/2  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelrelrrrigyvfqdpalfpeltvlenlalgal
00478412   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00379961   1/2  lldpkdlrellragiplvflnfaalpasllesel.................................lsg
00485932   2/2  ----------------------------------------------------------------------
00436511   1/2  GervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpal
00496111   1/2  saeelrerrrrigyvfqepalfpeltvlenlalgll..........................drlpgeld
00448931   1/2  aareqlgivfqdpgltvlenlalg................eleararellellgledydvvliDtagrlr
00495031   1/2  gkvlyigleltlsperlrlraqsl................gldldell.......erllvidllelvgll
00422141   1/2  ldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltled
00512892   2/2  ----------------------------------------------------------------------
00437981   1/2  gkdirrgiglvfqliglfphltvlelvalgl.ggilveevrellkel.......................
00480472   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00437941   1/2  elld............................................................pselsg
00512891   1/2  ..rsarrgigyvfq....................tveellgllaelvglevrgeleellktlikelsgge
00414122   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00485931   1/2  .............................rrigavpqlpvlfprltvlenlalggadlaeraeellellg
00387202   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00475371   1/2  sarellg........................................llgellgldvlvgarggdlsggl
00464791   1/2  vglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf..............
00480471   1/2  lldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpv
00426052   2/2  ----------------------------------------------------------------------
00457311   1/2  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk.....llepvglpevldryphel
00468601   1/2  aaae.rlgigavpqdvplfpsltvldnlalar..dlleaakaagydvvlidtaglld.ldrlvgelsggq
00379962   2/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00414121   1/2  d.......................gqlledlgvlavrlgigyvpqtlglfpaltvlellalalllredpd
00462762   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00478411   1/2  lglkdgigmvfqdpalfplltvrengvalglllag.......lskaeieervdlllelvglddlldrypd
00533502   2/2  ----------------------------------------------------------------------
00368571   1/2  elgrhllivGptGsGKStllrllaglllpd....ggrviviDpkgeyaglarglgvvildpgdgrsvrln
00426051   1/2  ggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirg...deeleaalelaglprviel
00371631   1/2  rlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDif
00503741   1/2  llagllkpkfgeillfgkvvyvnvselldlkellrll.................................
00404192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00368501   1/2  pGvGKTtlaralakll.......gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgt
00475381   1/2  ................lsrdllgllreglirigyvfqdyalfprltvlenvllgll.llgglvvildggv
00487022   2/2  ----------------------------------------------------------------------
00475521   1/2  eplr.........................rdigmvfqdpalfplltvrenvilgllelaglskaealarv
00392701   1/2  .......................................................sdllgkyvgelsggl
00478442   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00490731   1/2  rpaadellgvlaee........................................lgldvllgarggdlsg
00406781   1/2  .......................................................sellgkyvgelsggl
00451572   2/2  ----------------------------------------------------------------------
00532531   1/2  ggfyakaigllrrkigyvfqlfpfltvlenvalgld.....glvdeedl.......eraenllalvglee
00451571   1/2  aiglvtqdgelllelidegilvpdeiv.............iellrealeeldad.gvildgfprllgqae
00515531   1/2  gvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl...
00489571   1/2  .....................................................................l
00406782   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00462761   1/2  lr...........................lglliglvfqdpdllpfltvlenvllpllaaglivivdgtl
00477971   1/2  pgevdgvgyvfqsrelfpeltvagnfleg...........aevrgnlygtsrerveelleagldvlldid
00487021   1/2  lra..........gevfqdyalfphltvlelldnvllgleirgllk..aerlervevllervgl..lldr
00387201   1/2  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdp---------------
00490732   2/2  ----------------------------------------------------------------------
00432181   1/2  v......................................veldgrklvliDtpGleefa.......sgge
00532472   2/2  ----------------------------------------------------------------------
00532471   1/2  elggaalldivd................e.grliglvfqdldllpllevlellaarleellerippalsg
00496572   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00437901   1/2  elrd...................................................vddlsgyvgelsgge
00432182   2/2  ----------------------------------------------------------------------
00515511   1/2  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00367291   1/2  .......................................................selle..klvgegeg
00420941   1/2  .......................................................sellgkyvgelsggl
00484102   2/2  ----------------------------------------------------------------------
00404191   1/2  ...........................................................delvsklsggl
00379261   1/2  glrrpgknvlLvGppGvGKTtlaralAkll.......gapfvevdaselteg.gyvgedlekrirelfqe
00484101   1/2  dldellg.igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalpl
00477011   1/2  TLlnallGldvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenra
00386742   2/2  ----------------------------------------------------------------------
00470731   1/2  aralakel.......gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpd
00533501   1/2  epigtplgrgigyvfqdpalfpgltvrenlelll...................vfadrygvlrglikpal
00517691   1/2  .........................................gtlllllgllsfllalvldslplerergi
00477012   2/2  ----------------------------------------------------------------------
00496571   1/2  ir.......................geplgelirglvfqdpllldeltvlenlalgrylhlglilaalaa
00464411   1/2  eplge...........ligevfqdgilfpdltvlenvalgrygllglikealaegviv..ildrvglsdl
00437902   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00434401   1/2  paaelllreglgidfqlpdal.....................drellreevlellglgevvivdvydlsg
00498532   2/2  ----------------------------------------------------------------------
00405881   1/2  veldd........grqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqpvellsgg
00513762   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00439861   1/2  e.esreqlleraerlgldleellllgll...............................siliadplgls
00498812   2/2  ----------------------------------------------------------------------
00478441   1/2  ...........elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld...d
00437921   1/2  dlrgvddlreligevlqalglllgg.............................................
00480251   1/2  yrpsapeqlgilgellg.....................vpvvgvltgldlagalrealellllegydvvl
00480442   2/2  ----------------------------------------------------------------------
00510561   1/2  prGelvliaGppGsGKTtlalqlaanla.aqggkvlyis..teesleql...rarrlgld..........
00521551   1/2  ........................................................elvg..kyvgeleg
00517692   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00499191   1/2  ...............gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvv
00513761   1/2  ranlpeqlgidirdlidletvmelglgpngalvfaleellttldillealell.eedydyiliD......
00386741   1/2  .......................................................selsg........ge
00437922   2/2  ----------------------------------------------------------------------
00356411   1/2  kltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkw...................rnrlge
00394721   1/2  dlsellsv...................................................sdlvgeleggl
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  ....................................................................gq
00468951   1/2  GglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlrarrlgld.............
00499331   1/2  epvig.......................agtdigevfqdlllaggllvddevrrlllealdell.laggk
00367292   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00402371   1/2  daselle...................................................fgkyvgafeggl
00496061   1/2  evepggtdlgeifq....alllagellfddevlgll...rerldelielllagg.vvildgfpldlegal
00409842   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00410531   1/2  evdg.vkl.....................................................viwDtaGqe
00420942   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00482721   1/2  idtddlyrelvaggtplgerirellgegyllpdealfrallaellfgdllalalldgvvydrlrdellae
00489631   1/2  ridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidka...............ledgg
00409841   1/2  v.....................................................................
00493431   1/2  pgevrgigyvfqsgalfphlivagnllegaevhgllygtskerveeale..............kgllvll
00482551   1/2  naalplelgklggkvlyisteeafsperlreralsl.....................gldleelldrllv
00402372   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00416171   1/2  ......................................sgvpfvrvncsaltedlleselfghekgafgg
00472911   1/2  eggkpl.....................................................gllfedaleag
00498811   1/2  relvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvvile
00403152   2/2  ----------------------------------------------------------------------
00498531   1/2  rGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleqlrarrlgld.................
00533151   1/2  elvpggldig........................evfqdaleaglllfddefrglller..leellargp
00401211   1/2  ..........................................................ldtlkgelergi
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00444381   1/2  llellgarpgenvlLvGppGtGKTtlakalakll.......gvpfirid.....................
00482662   2/2  ----------------------------------------------------------------------
00482661   1/2  llakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfd
00430121   1/2  rgrkglelgirpggnvllvGPpGvGKTtlakalagllfp....sgvpfirinlselte............
00478391   1/2  idgddllrelvgeggrlgrdlfdedrllfrellideidl...............................
00401212   2/2  ----------------------------------------------------------------------
00480441   1/2  egevlgv.........dyvfvdrelfeelivagnlledaivhgllygtskerieealdaglgvlldgfpr
00461622   2/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00527261   1/2  kelgkpviyidlselsskgyvdleellrelaeelgellellkkl......................lkkl
00418302   2/2  ----------------------------------------------------------------------
00516041   1/2  ...lrgeelgriielfdearelvpelal.............lfideidell.......akgkvvild...
00476072   2/2  ----------------------------------------------------------------------
00478081   1/2  rreairelllgldlleilf..........................................eglllsdef
00473941   1/2  ..................................................pfielsasdllgesdlrggf
00430122   2/2  ----------------------------------------------------------------------
00489391   1/2  ...............................eavpggtdlgelfqdlllegellfideiaelllealae.
00487062   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  egvll....................ggpllerirellgegyllfdealdrellaallfglelegalldgl
00508671   1/2  ........................eepgsgvvlldgddlraglsiglilsdedraalrrrlgevfqelll
00457851   1/2  re............avpggtrlgeviqdlfllggllffdeldellkerieellaag.gvildgfpldleg
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00476651   1/2  vGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll......................
00496062   2/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00462581   1/2  llyGppGtGKTtlaralakel.......glpfvrinasd...............................
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  viyepvdywaavgggdllrlirelllrlgfgepdafdnellgellealleg...................
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  rpkvdfddii.leeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgr
00478392   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  elteaelvGyesgarlrelf..................................................
00474201   1/2  Ttlaralanelprslpglpfvrvnasdltdvglleellgkllgaat........................
00469161   1/2  ............................dgfgtplgelirelllegfqdlilvpdllvlellaanraglr
00480501   1/2  alvggl..............................................idgllilfledeaalsel
00457881   1/2  llrelepdgtelgellqdlllag.................gllpdaivrdlllelleelladgkgvildg
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  idldalaellfgdvgglvvdli...........................................dleav
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00378621   1/2  ...........................................................geef..dtpgt
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  ........................................................rllggefai..ygp


                         +         -         -         -         -         *         -:210
query           TRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLAD
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00490801   1/2  lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetrael
00490802   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ..lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetra
00367902   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00379581   1/2  vgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvt
00500442   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00458601   1/2  gledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtH
00422801   1/2  ralellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrela
00420702   2/2  ----------------------------------------------------------------------
00475891   1/2  seLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrlad
00378981   1/2  SgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladri
00425572   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00482201   1/2  seLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.rlad
00500441   1/2  eLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrlad
00502741   1/2  rqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvldd
00436512   2/2  ----------------------------------------------------------------------
00420701   1/2  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr
00530592   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00482261   1/2  seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal.lad
00425571   1/2  rqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvld
00404101   1/2  rqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrlad
00530591   1/2  lllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltv
00475991   1/2  llgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllv
00475992   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00372301   1/2  lpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaal
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00466971   1/2  lldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdlde
00466931   1/2  dlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpv
00390411   1/2  rrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllel
00488522   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00367901   1/2  qltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeelle
00485452   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509431   1/2  igyvpqdpn..llfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeele
00436071   1/2  GqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv-
00440861   1/2  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00498252   2/2  ----------------------------------------------------------------------
00361211   1/2  drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilv
00488521   1/2  ellerlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllre
00468692   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00367481   1/2  sdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtH
00496112   2/2  ----------------------------------------------------------------------
00424961   1/2  sllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDep
00469451   1/2  pgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilv-----
00485451   1/2  lldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthd
00464792   2/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00381441   1/2  ldadlviilpasleellerldrrggelsggqkqRvalarall----------------------------
00498251   1/2  ................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllr
00422142   2/2  ----------------------------------------------------------------------
00379601   1/2  edllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel..
00500612   2/2  ----------------------------------------------------------------------
00503371   1/2  eliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkel
00500611   1/2  lldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvth
00495371   1/2  elldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthd
00457312   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00468691   1/2  lag..........................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEpt
00478412   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00379961   1/2  gerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpagvtv
00485932   2/2  ----------------------------------------------------------------------
00436511   1/2  pallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlft-------
00496111   1/2  lSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeae
00448931   1/2  lpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...glt.vlvvthlDlla
00495031   1/2  elldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthd
00422141   1/2  lglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedpieyvfqspnlfp
00512892   2/2  ----------------------------------------------------------------------
00437981   1/2  ..............................lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLl
00480472   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00437941   1/2  gerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeldpallsRfdv
00512891   1/2  kqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladriallrr
00414122   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00485931   1/2  legfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda.....lrlllellke
00387202   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00475371   1/2  rqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadril
00464791   1/2  ..............aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgld
00480471   1/2  illlnkidllddrllrraeaeerieel-------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00457311   1/2  sgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlgeagrs
00468601   1/2  kqrvaiarala.apevllldeptsglda.....laellelleelgltvlvvtKlDgtakgghdlslalrl
00379962   2/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00414121   1/2  lilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDl
00462762   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00478411   1/2  elsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.ldiilalel----------
00533502   2/2  ----------------------------------------------------------------------
00368571   1/2  plalidde.......edaaellralvsemgrgeddfftpaarallralilalaeepeptl----------
00426051   1/2  lle..gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRll----------------
00371631   1/2  ylpaeqlkrigllfqkglpealdveellellldlke..................................
00503741   1/2  .......lealglpppyq.....lsggerlrvalaeallalgkpdllilDEitnlldp------------
00404192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00368501   1/2  vlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldl----------
00475381   1/2  rqrlalarallldpdvllldeplllldaalr---------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00475521   1/2  dellelvglddellldrlp...sggqqqeilrvaiallilpvll--------------------------
00392701   1/2  rqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgv----------
00478442   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00490731   1/2  glrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilv
00406781   1/2  rqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgv----------
00451572   2/2  ----------------------------------------------------------------------
00532531   1/2  ipnrypselsgGqqqrv...........illldEPtsgLdpvs---------------------------
00451571   1/2  lllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkk-----------------
00515531   1/2  .anvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkq----------------------
00489571   1/2  allelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aDrvavldd
00406782   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00462761   1/2  llvglrealrkllgllsgGqkqrvadlvvlldadpevllaRep---------------------------
00477971   1/2  pqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealel
00487021   1/2  ippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllr------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00432181   1/2  kqrvalalallreadvlllvvdadeptsfldle....llellrelllagkpvilvlnKiDlldareelak
00532472   2/2  ----------------------------------------------------------------------
00532471   1/2  gqgqrvildrslysrpavlllllyvdeplsgldvelreelr-----------------------------
00496572   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00437901   1/2  klrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliilttnd----------
00432182   2/2  ----------------------------------------------------------------------
00515511   1/2  pillvlnKiDlleaklvllllvglfdlldglpselsggqkqrval-------------------------
00367291   1/2  rlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvlsgvlvi----------
00420941   1/2  ..rqllalaraakpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnv----------
00484102   2/2  ----------------------------------------------------------------------
00404191   1/2  qeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqa------
00379261   1/2  arllvfltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvll------------
00484101   1/2  ilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildl----------------------
00477011   1/2  lagpiagisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknp----------
00386742   2/2  ----------------------------------------------------------------------
00470731   1/2  vildgagrtpeqlealldllee................--------------------------------
00533501   1/2  aegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelre
00517691   1/2  tidvalarllldgrkilllDtPGhedfvkevlralrladgallvvdadegvslpqtrevlllllllgvpn
00477012   2/2  ----------------------------------------------------------------------
00496571   1/2  gvgvvldrvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeR-------------
00464411   1/2  a..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRgrllekleyikk------------
00437902   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00434401   1/2  gerqr...aralasgpdvlilDgptlgldv............lldlpdlvi-------------------
00498532   2/2  ----------------------------------------------------------------------
00405881   1/2  ekqrlalarallgkpvilvlNKiDeptneldlelle----------------------------------
00513762   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00439861   1/2  geellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsq----------
00498812   2/2  ----------------------------------------------------------------------
00478441   1/2  rypyelsggerqrvailr..vllpklllpdepgrnldvliev..avlnlilkllgid-------------
00437921   1/2  ...............kpdvlllDEi.drldpdaqnallklleel.pagvtlilttnrlee----------
00480251   1/2  iDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldg.vv-----------
00480442   2/2  ----------------------------------------------------------------------
00510561   1/2  .................ldrlllldaltveellalaerllsggkvdlvviDsltalapalelsllldept
00521551   1/2  glrqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnv----------
00517692   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00499191   1/2  lldryprllsggqrqrvaia.....dp-------------------------------------------
00513761   1/2  ................................................tpGglelralla----------
00386741   1/2  klrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllp----------
00437922   2/2  ----------------------------------------------------------------------
00356411   1/2  vlqllelilnltvlenvpiilvlNKiDlleekiveellellgleykgdrdpee-----------------
00394721   1/2  ..rglltealalakpsvlflDEidrlldardsesslevlnaLlrlledg.....................
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  kqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvlllde
00468951   1/2  ...........................lddllllpaltveellalaerllsggkpqlvviDsltalrpal
00499331   1/2  vvildgfpggllqrealrrllprpdlvilldap....peelleRllkrgrldgreddslellekrlerye
00367292   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00402371   1/2  rqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nvrviaatnrpelvklg-
00496061   1/2  llrealarallpdl.vifldap....leelleRllkrgrllereddseevlekrlerylelyerliepyk
00409842   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00410531   1/2  rfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrevsae
00420942   2/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00482721   1/2  lsggqgdvliiegalllepgllplpdlvifldap.pevlleRllkRg..gdseeeiekrleryre.iapl
00489631   1/2  vvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleery.....
00409841   1/2  .........vlldgrdllllDtPGlidfaseptnlldleiieallraleeadvvllvvdadrglleqdle
00493431   1/2  drdlsggqqlrvalaralvvfildpslelldeRlsgrdadtre---------------------------
00482551   1/2  idatdlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakel
00402372   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00416171   1/2  gekqrlgllrla..dggvlflDE.idkldpdvqnaLlr--------------------------------
00472911   1/2  frqrladlirallakgkvvild..gtglsreareellellkelgpvlvifldadpevlleRllkrgrall
00498811   1/2  gplllsgglrqrpdlvifldappevlleRllkRggldeetiek---------------------------
00403152   2/2  ----------------------------------------------------------------------
00498531   1/2  .......................ldellllpaltveellalaerllsggkpdlvviDsltalapslllld
00533151   1/2  vvildgfpggllqrealrrlllrpdlvifldaple....elleRllkrgrlirleddseevlekrleryl
00401211   1/2  tikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhedflkellralaladgallvvda
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00444381   1/2  ...................................gselte...kelvGesegailsggf----------
00482662   2/2  ----------------------------------------------------------------------
00482661   1/2  dlvgqeeakeallenlklflkgpellldlglpkgrgllLyG-----------------------------
00430121   1/2  ...................................kll--------------------------------
00478391   1/2  ..........llakgkvvildgtnlsealdealrrllrpdlvifldapleelleRllkrgrhpeseevle
00401212   2/2  ----------------------------------------------------------------------
00480441   1/2  glsqaqalrlaldlvllldpslevlleRllgrgddteevir-----------------------------
00461622   2/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00527261   1/2  sellglsilglelilglsggdleelleelaellkklgkpvililDEiqslldvsskelleaLl-------
00418302   2/2  ----------------------------------------------------------------------
00516041   1/2  ...gtgrlleldealellgpdlvifldap....peelleRllkr.......gldeeaieerlerlreile
00476072   2/2  ----------------------------------------------------------------------
00478081   1/2  relleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevlleRllkRgrr
00473941   1/2  kqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvvelllllp----------
00430122   2/2  ----------------------------------------------------------------------
00489391   1/2  ...........aegkvvildgtg..ldieqrealrelllelprpdlvifldadpeelleRllkrglrper
00487062   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  vygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldappevlleRllkRg..gdsleeiek
00508671   1/2  agrlvvldgtalglelrdelrellkeaglpllvvfldaplevlleRdrr---------------------
00457851   1/2  aealreallragplpdlvifldaple....elleRllkrgr..eplddteevilkrlerlrelyerliep
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00476651   1/2  .....................-------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  -------------------------nellrpivanvdlvlivvdardplfslnlllrylvlaeaagippv
00462581   1/2  .........................llvgllvgelegrlr.glfteavlanpgvlflDE.----------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ..........gkivlsarraqlleirlirpllaegkvvilDrepdsad----------------------
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  l......pfirvn........-------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  .................aragigllaladpgvlflDEi.dkllpargssggdvsredv------------
00474201   1/2  .....................................fllakpgvlflDE.idkldpdvq----------
00469161   1/2  elikellaa.gkgvildrfplsrlayqlsggerqrlaidlegalllerllldepfpd-------------
00480501   1/2  vlevllealegggnpdvvildgtnlleedrellrellkrlgrpdlvifldapleellerllkrgredls-
00457881   1/2  fprdleqaealrallaelglppdlvifldaple....vlleRllkrg......ddpeealekrlklyepl
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  erhlldiaeellengeilildeptvgld------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00378621   1/2  tiginfgtveldgvklqlwDtpGqerfrsltlrylenadvvllvvdasdpdsfeellelleellelllla
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  tiginfgtveldgvklqlwDta..GqerfrslwllylrgadavllVvdatdgdsfeelkellleilelll


                         -         -         -         +         -         -         -:280
query           CTLAETGTTTELLQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLS
00422802   2/2  -----------------------------llllllallllllllllldpllelenlsksyggrlvlalkd
00379582   2/2  ----------------------------------------------lepllevenlsksyggvlalkdvs
00390412   2/2  ---------------------------------------------------------Mknlslrygnfra
00490801   1/2  lellrelakegktvllvtHdlseal.ladrilvlddGriveegtpeell---------------------
00490802   2/2  --------------------------------------------------llllllllalllelleeeee
00436072   2/2  ------------------------------------------------pllelenlsksygg.lalkdvs
00510252   2/2  --------------------------------------------------lllllllllaeellelleee
00510251   1/2  ellellrelakegktvllvtHdlseal.ladrilvlddGriveegtpeel--------------------
00367902   2/2  --------------------------------------------------lelknlslsyg.ksilkdvs
00378982   2/2  -----------------------------------------------lpllelenlsksyggvlalkdvs
00379581   1/2  hdldealrladrilvlddGrivelgtpee-----------------------------------------
00500442   2/2  --------------------------------------------lllelllelknlsksyggvlalddvs
00475892   2/2  --------------------------------------------lllelllevknlsksyggvlalkdvs
00458601   1/2  dldealrladrilvlddGriveegtpeellenpl------------------------------------
00422801   1/2  k.gltvllvth-----------------------------------------------------------
00420702   2/2  -----------------------------------------------lpllelenlsksypgggvlalkd
00475891   1/2  rilvlddGrivelgtpeellenpgll--------------------------------------------
00378981   1/2  lvlddGrivelgtpe-------------------------------------------------------
00425572   2/2  --------------------------------------------------lelenlsksyggvlalkdvs
00509432   2/2  --------------------------------------------------Mlelknlslsnfr..vlkde
00404102   2/2  ----------------------------------------------------elenlsksyggvlalkdv
00466972   2/2  ---------------------------------------------llalllevknlsksyggvlalkdvs
00458602   2/2  --------------------------------------------------lllevenlsksyggvlalkd
00482202   2/2  -----------------------------------------------llllelknlsksyggvlalkdvs
00482201   1/2  rilvlddGrivelgt-------------------------------------------------------
00500441   1/2  rilvlddGrivelgt-------------------------------------------------------
00502741   1/2  Grivelgtpeellen-------------------------------------------------------
00436512   2/2  --------------ievpvglallgrvldllgepid...gkgplelgepllevenlsksyggrklvlepl
00420701   1/2  ilvlddGrivelgtp-------------------------------------------------------
00530592   2/2  --------------------------------llllllaleelpllgelllevknlsksyggvlalkdvs
00372302   2/2  --------------------------------------yvlPllsdgmpllelenlrkpyggllvlndvs
00482261   1/2  rilvlddGrivelgt-------------------------------------------------------
00425571   1/2  dGrivelgtpeelle-------------------------------------------------------
00404101   1/2  rilvlddGrivelgtpeellenpl----------------------------------------------
00530591   1/2  llvtHdlseal.ladrilvlddGrivee------------------------------------------
00475991   1/2  tHdlsealrladrilvlddGrivee---------------------------------------------
00475992   2/2  ------------------------------------lllaaelpelgelllevvnlsksyggvlalkdvs
00440862   2/2  ----------------------------------------Mpllslgepllelenlsksyggvvalkdis
00482262   2/2  ------------------------------------------------lllevenlsksyggvlalkdvs
00372301   1/2  ladrvvvlndgrivavg-----------------------------------------------------
00466932   2/2  ---------------------------------------------------------Mkllslslgnfra
00361212   2/2  -----------------------------------------plellgepllelenlsksyggitalddvs
00502742   2/2  ------------------------------------------------lllevenlsksyggvlalkdvs
00466971   1/2  alrladrilvld----------------------------------------------------------
00466931   1/2  stLSGGerqrv-----------------------------------------------------------
00390411   1/2  leglkee---------------------------------------------------------------
00488522   2/2  ----------------------------------------lllllalelllevenlristgikeldklls
00469452   2/2  ------------------------------------------------allelenlskiyggvpkalddv
00367482   2/2  ---------------------------------------yvrPelldepllelengrhPllsksyggkvv
00367901   1/2  llglgglldrp-----------------------------------------------------------
00485452   2/2  ----------------------------------------------------------skiygd.ealkd
00424962   2/2  -----------------------------lgepldglgplr....papgllelenvsksygtgialidls
00509431   1/2  ligplldglellvgl-------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00440861   1/2  pglvvlisaltgegldeltvre------------------------------------------------
00498252   2/2  -----------------------------------------------vekllglalllieklflkvlprl
00361211   1/2  thdldlldsallr---------------------------------------------------------
00488521   1/2  llrlLkrlakelgvt-------------------------------------------------------
00468692   2/2  -------------------------------lsvpvglallgrvldvlgepidglgplllllllpivrla
00379602   2/2  --------------------------------------------ltledllelenlsfsyggkealkdls
00503372   2/2  ---------------------------------------------------------Mmlkslelknfks
00381442   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------esalellleledltklst
00367481   1/2  dlelaalaadriv---------------------------------------------------------
00496112   2/2  ----------------------------------------------------elenltklytgikaLddl
00424961   1/2  tsalDgeivlsl----------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00485451   1/2  lreae..adrilvlrkgdivelg-----------------------------------------------
00464792   2/2  ------------------------------------------------lsvpvgdkllGrvldvlgepid
00448932   2/2  -----------------------------------------------------------------Lddvs
00381441   1/2  ----------------------------------------------------------------------
00498251   1/2  lakelgvtvllvthdlde----------------------------------------------------
00422142   2/2  ---------------------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgg
00379601   1/2  .............lr-------------------------------------------------------
00500612   2/2  ----------------------------------------pgllsllelllelenltklptgipaLddv.
00503371   1/2  ekrlellekeleel--------------------------------------------------------
00500611   1/2  dlreveeladkrdrvv------------------------------------------------------
00495371   1/2  leeveeladrvavlag------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00468602   2/2  -------------------------------------------------------------------dls
00468691   1/2  sgldalre..ilell-------------------------------------------------------
00478412   2/2  -------------------------------------------------------------Ggvlalhgv
00437982   2/2  ----------------------------------------------lveklrpknldkvigqeealkdls
00379961   1/2  iaatnddlgeldpalldRfdlvielgplrdreerle----------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  dladsgriavladgrivlegdla-----------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00495031   1/2  lrevegrleladrvvv------------------------------------------------------
00422141   1/2  l...................--------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00437981   1/2  klleelak.gvtvila------------------------------------------------------
00480472   2/2  ---------------------------------------------------------------------s
00475372   2/2  ----------------------------------------------------------------alddvs
00495032   2/2  -------------------------------------------lsalellleledltkistgipaLddvl
00532532   2/2  --------------------------------------------------------------vlalkdvs
00475522   2/2  -------------------------------------------------------------evlalhgvs
00437941   1/2  iefpppdeeellei--------------------------------------------------------
00512891   1/2  grivelgplseeelleilrrrlnr----------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00371632   2/2  -------------------------------------------------mseliiylelselewallrad
00485931   1/2  lgltvlvvthddgtak------------------------------------------------------
00387202   2/2  -------------------------------------------mssgepllevenlskryggklalkdvs
00503742   2/2  ---------------------------------------------------fifldlrplallplpdrlv
00475371   1/2  vldlggiv--------------------------------------------------------------
00464791   1/2  al.reillllgel---------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00457311   1/2  adrvlgriveqgppeelfinpqhpyad-------------------------------------------
00468601   1/2  adrilvlgvGeivedg------------------------------------------------------
00379962   2/2  -----------------------------------------------yrpvdfdd...ivGqeealrals
00405882   2/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00462762   2/2  -----------------------------------------------------------yygdvtaldgv
00477972   2/2  ----------------------------------------------------------------------
00434402   2/2  ---------------------------------------------------------ksyggllalddvs
00475382   2/2  ----------------------------------------------------------------------
00368502   2/2  --------------------------------------------kerllllelrnvllddviGqeeakea
00437942   2/2  -------------------------------------------lrplveklrpknlddvygqeevlkals
00493432   2/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00371631   1/2  ..........------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00404192   2/2  --------------------------------------------vellpkvtlddlvgleelkealkeal
00489572   2/2  -----------------------------------------------------rvknlsksyggktaldd
00368501   1/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00478442   2/2  -------------------------------------------------------------aevlalhgv
00392702   2/2  -----------------------------------------------------------agarlaledls
00515512   2/2  ----------------------------------------------------------------------
00368572   2/2  -------------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtld
00513252   2/2  --------------------------------------------------------------iellsdls
00356412   2/2  ----------------------------------------------------lknlsksygilkalkdis
00515532   2/2  ----------------------------------------------------------------------
00490731   1/2  lleglgvpgvvlNkl-------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ......Gtpeellarpanpyvrellgavpgllllalllllelllll------------------------
00406782   2/2  -------------------------------------plveklrpvllddvigqeeakeallealaglrl
00464412   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  -------------------------------------------------------------------dvs
00432181   1/2  llgvpvvevSaktgegvdellealae--------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00379262   2/2  -----------------------------------------------------------drllleelrpv
00470732   2/2  ---------------------------------------------------------------------a
00437901   1/2  ----------------------------------------------------------------------
00432182   2/2  ---------------------------------------------------------------------s
00515511   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00386742   2/2  -----------------------------------------------klrpvllddvvgqeeakeallea
00470731   1/2  ----------------------------------------------------------------------
00533501   1/2  ldseevlekrlehyle....llekad..rv----------------------------------------
00517691   1/2  iivvlNKiDlvdaeeleevleelre---------------------------------------------
00477012   2/2  -----------------------------------------------------------------eelrk
00496571   1/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00437902   2/2  -----------------------------------slllvekyrpvllddvvgqeeak....ealleala
00499192   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00510561   1/2  sgldasllreilr---------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00517692   2/2  --------------------------------------------------------------------ls
00521552   2/2  -------------------------------------plveklrpvllddvigqeeakeallealarlka
00499191   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------lglllveklrpkllddvvgqeealerlllalk....
00356411   1/2  ----------------------------------------------------------------------
00394721   1/2  ...nvlviattnrpellgrleldpallr.rfdvielgppdeeel--------------------------
00410322   2/2  -----------------------------------------------------------yggllllkdls
00513251   1/2  gslvdlgvledlla--------------------------------------------------------
00468951   1/2  llldeptgellgldvrllse--------------------------------------------------
00499331   1/2  eltrdlielyeeadrvividag------------------------------------------------
00367292   2/2  ---------------------------------------------vtlddvvgqeeak....ealleale
00472912   2/2  ----------------------------------------------------------------------
00508672   2/2  ---------------------------------------------------------hvsllklgeld.i
00527262   2/2  -----------------------------------------------------------npfilgpkvdl
00402371   1/2  ----------------------------------------------------------------------
00496061   1/2  kadyvividasgsieevveeil------------------------------------------------
00409842   2/2  --------------------------------------------------------------------ls
00468952   2/2  ----------------------------------------------------------------------
00410531   1/2  lalelakelgikfietSAktgegvd---------------------------------------------
00420942   2/2  ------------------------------------------------------------------lgls
00489632   2/2  ----------------------------------------------------------------------
00482721   1/2  leaadlvidndg.sleevveqilelleellklasl-----------------------------------
00489631   1/2  ...radlvivtddl...........---------------------------------------------
00409841   1/2  llelllelgkpvilvlNKiDlldaee--------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00482551   1/2  g---------------------------------------------------------------------
00402372   2/2  ------------------------------vlektgipltkllrpvllddviGqeealea....llealr
00499332   2/2  ---------------------------------------------------------------------P
00416171   1/2  ----------------------------------------------------------------------
00472911   1/2  reevldrllevrepy.elleeadlvid-------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00498531   1/2  epgrvtqgldarl---------------------------------------------------------
00533151   1/2  klyerliepyeeaddvividasgsie--------------------------------------------
00401211   1/2  degeflpqtlevlllllelgvkp-----------------------------------------------
00394722   2/2  --------------------------------------------------------------eealeall
00410532   2/2  ---------------------------------------------------------------gelknls
00480252   2/2  -------------------------------------------------------------------Edl
00444381   1/2  ----------------------------------------------------------------------
00482662   2/2  -----------------------------------------------------kkvaivllsnyalsisl
00482661   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00478391   1/2  erleryepllepea...adlvid-----------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00444382   2/2  --------------------------------asdelekllelrpvlledvigqeeakkalslalelplk
00515352   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00418302   2/2  -----------------------------------drplleklrpvllddviGqeeak....kalleala
00516041   1/2  pleeaddlvidtanldleevveeilellee----------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478081   1/2  erkddseevlellekrleryep------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00430122   2/2  --------------------------iPvsklleddrplleklrpvlfddvvgqeeak....eallealr
00489391   1/2  egdseevlekrlerylellerlie----------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00416172   2/2  -------------------------------------------------------diigqeeakkallea
00378622   2/2  ------------------------------------------------------------glklllrrls
00476071   1/2  rlerylelaplye.eadlvidnd-----------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00457851   1/2  yeeaddvividaslsieevveeilell-------------------------------------------
00533152   2/2  ---------------------------------------------------------------------M
00473942   2/2  ----------------------------------------------eklrpvllddvv..gqeevkkall
00476651   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  lvlnKiDlleeeedlelleellkelesigvdvvlvsakkg..............................
00462581   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00511382   2/2  ---------------------------------------------------------------------l
00471272   2/2  --------------------------------------------------------------prailele
00497571   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00457881   1/2  lelyeeadylividaslsieevve----------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ------------------------------------------------------------glkglllrlk
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00378621   1/2  gvpiilvlNKiDlldaallre-------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ------------------------------------yeplveklrpvllddlvgqeeakealleala...
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  -----------------------------------------aselvqwlldlgildeseilledlenala
00486922   2/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------alknil
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  -----------------------------------deelelleklslllveklrpvllddlvgqeeak..
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------edleslllnplvkfed.ivpkvld
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  lagvpiilvgNKiDllealslrevs---------------------------------------------


                         -         *         -         -         -         -         +:350
query           WRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYR
00422802   2/2  vsltvkpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgldilalslaelrrrigyvfqdpalf
00379582   2/2  ltvkpgeivalvGpnGsGKSTllkllagllk.ptsGeilldglditalslaelrrrgigyvfqdp..alf
00390412   2/2  lkdvslelppG.ltalvGpNGsGKStLlkalagllgp.dsglrvgklsdlirrgadkasvelvfeldggl
00490801   1/2  ----------------------------------------------------------------------
00490802   2/2  llllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllk.pt
00436072   2/2  ltvepgeivalvGpnGaGKsTllkllagllk.ptsgeilldgldlla......lrrgigyvfqdp.alfp
00510252   2/2  elllllllllllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllk.
00510251   1/2  ----------------------------------------------------------------------
00367902   2/2  leip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgllllprstvatvelifdllg
00378982   2/2  ltvepgeivalvGpnGaGKSTllkllagllkp.tsGeilldgldllllslaelllllrrgigyvfqdp..
00379581   1/2  ----------------------------------------------------------------------
00500442   2/2  ltikpgeivalvGpnGaGKSTllkllagllk.ptsGeilldgkdildlsl...lrrgigyvfqdpa..lf
00475892   2/2  ltikpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgkdilglsllellrrgigyvfqdpalfpg
00458601   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00420702   2/2  vsltvepgeivalvGpnGsGKSTllkllagllk.ptsGeilldgldllllslaellalrrgigyvfqdp.
00475891   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ltvepgeivalvGpnGaGKSTllkllagllkp.tsGeilldgldllalsl...lrrrigyvfqdp..alf
00509432   2/2  lvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdliflgslirsgadrasvelvfd
00404102   2/2  sltvepgeivalvGpnGaGKSTllkllagll..ptsGeilldgldltalslael.rrgigyvfqdp..al
00466972   2/2  ltikpgeivalvGpnGsGKSTllkllagllk.ptsGeilldgkdilglslaelllllrrgigyvfqdpa.
00458602   2/2  vsltikpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgkditglspqelrrlggvvvqevllf
00482202   2/2  ltikpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgkdilglslkel...rgigyvvqqdall
00482201   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00436512   2/2  etgialddvsltikkGervglvGpsGaGKtTLlkllagllk.pdsGeilvdgligerlrevlelirelel
00420701   1/2  ----------------------------------------------------------------------
00530592   2/2  ltikpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgkditdlslkel...rgigyvvqqdall
00372302   2/2  l...pgeivaltGpnGaGKSTllrllaglllpa.sggilvdgedlr...........igyvfq.......
00482261   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475992   2/2  ltikpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgkdildlslaelrgigyvfqqdallpsl
00440862   2/2  lsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgllkpd.egvilvggkgvTrdiv
00482262   2/2  ltikpgeivalvGpnGsGKSTllkllagllkpt.......sGeilldgkdildlslaelrgigyvfqqda
00372301   1/2  ----------------------------------------------------------------------
00466932   2/2  lkdvslelp.geltalvGpNGsGKStLlkalagllgpd.sGeilldgkdilalspeellrllrrrigyvf
00361212   2/2  lgirkGeivllvGpsGsGKStllrnllaglla.ptggsvlldgleisalslaerlragigyvfqdl.alf
00502742   2/2  ltikpgeivalvGpnGsGKSTllkllagllk..ptsGeilldgkdilglslael...rgigyvfqqlall
00466971   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00488522   2/2  gglppgeitlivGpsGsGKTtLllqlavngllppdsGei.................ggkvlyvdqeeslf
00469452   2/2  slgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqd
00367482   2/2  lndislsip.gellvitGPngsGKSTllralaglllpa.sggilvpgedalll.................
00367901   1/2  ----------------------------------------------------------------------
00485452   2/2  vsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlvigldifrlsa.relrkri
00424962   2/2  lpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpp
00509431   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00498252   2/2  lsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpg.ggvvyidge
00361211   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00468692   2/2  ppllelenlsksygtgialidvsltigrGervglvGpnGaGKttLlkllagllkpd.sgeilvdGedlr.
00379602   2/2  laiepgelvlivGptGsGKTTllkallgllppd.egiitiegpdel.......lrnkigyvfQdpv...l
00503372   2/2  lkdvsligdfspg.ltaivGpNGsGKStlldaiagllgp.dsgeirldgkdlliylsdlirrgagiayve
00381442   2/2  -----GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltfls.reeigyvfqe
00495372   2/2  gikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp....evlvdgldltglspa...rggi
00367481   1/2  ----------------------------------------------------------------------
00496112   2/2  lslgippGeivllvGpsGsGKTtlalrllagllkp.tggkvliigle.lsaeelrerrrrigyvfqepal
00424961   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00464792   2/2  glgpllalerlpierlappllelenlskrfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagll
00448932   2/2  lsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla......areqlgivfqdp....
00381441   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00422142   2/2  gllrvryridgvlielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdig
00379601   1/2  ----------------------------------------------------------------------
00500612   2/2  lgggipkGeivllvGpsGsGKTtlllqlagllapd.......sgeillggkvlyisleeslrrrrigmvf
00503371   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00457312   2/2  ---mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsreelrklrrrigmvfqdpal
00468602   2/2  levkkgevialvGpnGvGKTTllakLagllapqgg..kvlllgaDiyraaaae..rlgigavpqdv..pl
00468691   1/2  ----------------------------------------------------------------------
00478412   2/2  sldve.gevvlltGpsGsGKStllralaglGtilldgdlvrlglkd...........gigmvfqdpalfp
00437982   2/2  lalkpgeiphalllvGppGsGKttlaralagll.gpdsgkilldgkdi.........rrgiglvfqli..
00379961   1/2  ----------------------------------------------------------------------
00485932   2/2  LsvpkgevvalvGpnGaGKTTllallaglla.ptggkvllvgadi..........rrigavpqlpvlfpr
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00512892   2/2  ------evilltGppGvGKTTlakalagelgakf.......gsvsltgrdvrsarrgigyvfq.......
00437981   1/2  ----------------------------------------------------------------------
00480472   2/2  leikkgekvaivGpsGsGKSTLlnaLagl.lsptsvpettrdfilgeilldgkdltlvdtpgiargrlkl
00475372   2/2  lsikkgevialvGkgGvGKTTlaanlagllaptgg..kvlligaDi........................
00495032   2/2  sggipkGelvllvGpsGsGKTtlllqlagllalglgliplggkvlyiglelt..lsperlrlraqsl...
00532532   2/2  lviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfyakaigllrrkigyvfq...
00475522   2/2  ldve.gevvllvGpsGsGKStllralag......sGeilvdgdlv....dleplrrdigmvfqdpalfpl
00437941   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00414122   2/2  ---kpgevvllvGpsGaGKTTLlrallgll.eglkvaviepdfgeilidgqll.edlgvlavrlgigyvp
00371632   2/2  vgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgklalddvslsvkkpeiigiaGp
00485931   1/2  ----------------------------------------------------------------------
00387202   2/2  lsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsleealll
00503742   2/2  grdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgei.llfg.....
00475371   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00426052   2/2  ---kpgevialvGpsGsGKSTlakllakelglef..idsgdilrdgvdlggesglllrdlrrliglvfqd
00457311   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00379962   2/2  lalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldpkdlrellragiplvflnfa
00405882   2/2  -----gervglvGrpgaGKSTLlnaltglk..aivsgypgttldpnlgvveldd................
00414121   1/2  ----------------------------------------------------------------------
00462762   2/2  sltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.......lglliglvfqdpdll
00477972   2/2  ---hkgelvvlvGPsGaGKsTLlnaLlgllptsgvisvsgttrpprpge.....vdgvgyvfqsrel.fp
00434402   2/2  lsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaell....lreglgidfqlpd
00475382   2/2  ---mkgeiialtGpsGsGKsTlarlLagllk.ptsgivsvdglrlavlsrdllgllreglirigyvfqdy
00368502   2/2  lsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakllgapfiridgseltek.dyvGes
00437942   2/2  lalekgrpehlllvGppGtGKTtlakalaglllptsg...................gvrvlgidaselld
00493432   2/2  ----kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgevr.......gigyvfq.sga
00478411   1/2  ----------------------------------------------------------------------
00533502   2/2  ----rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp.....lgrgigyvfqdpalfpg
00368571   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00404192   2/2  ellslgikpgeivllyGppGtGKTtlakalanelkkr.ggrvlyvsa.......................
00489572   2/2  vslsvepG.ivgLlGpNGaGKSTllrllaGllkpt...................................
00368501   1/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00487022   2/2  -rm...kiivltGpsGsGKsTlarlLaell...........gvvvidtddllra....gevfqdyalfph
00475521   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00478442   2/2  sldin.gegvlivGpsGsGKStlalaLaglGailvdddlvll..........elrgrdilmvfqppalfp
00392702   2/2  lgirpgknvlLvGppGvGKTtlaralagll......gap.fgrvdasd......................
00515512   2/2  ----kgekvlllGlsgsGKSTllnrllgleflpgpTigpte.gtieidgvklqlwDtgGqerfrslwlly
00368572   2/2  lgel.grhllivGptGsGKStllrllaglllpdggrviviDpkgeyagla..rglgvvildpgdgrsvrl
00513252   2/2  lsipspevvllvGppGsGKstlakklaellgfilidaddlr.............................
00356412   2/2  lelkkgikilllGlsgsGKSTllnrllgle.ygpTigine.gtieidgvkltlwDtgGqesfrklwilyf
00515532   2/2  ----kgekvallGlsgsGKSTllnrllglefa........ygpTigptsgtieidg.vklqlwDtgGqer
00490731   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00451572   2/2  MsikkgeiiaivGppGsGKsTlaklLakll...........glivldgddl.....lreaiglvtqdgel
00532531   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00406782   2/2  llkdlslgippgknvllvGppGtGKTtlakalagel..gvp.....fvrisase................
00464412   2/2  --vkkgeiivllGpsGsGKsTlaklLagllgptggsv...lltgepvsgeplge...ligevfqdg.ilf
00462761   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  lsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellg................
00432181   1/2  ----------------------------------------------------------------------
00532472   2/2  ----pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivde..grliglvf
00532471   1/2  ----------------------------------------------------------------------
00496572   2/2  ----GkgelivllGpsGsGKsTlarlLagll.....ggsvldtgepirgeplgelir..glvfq..dpll
00439862   2/2  --kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlakn..ggkvlyisleesr
00379262   2/2  llddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkll........
00470732   2/2  rpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralakelgagfilidgddlrek
00437901   1/2  ----------------------------------------------------------------------
00432182   2/2  lelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvveldgrkl..............
00515511   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00484102   2/2  ----kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldldellgigylfqdvgll.....
00404191   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00386742   2/2  lkavllgirpgehllLvGppGtGKTtlaralagelga.................................
00470731   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00477012   2/2  lldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvl
00496571   1/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00437902   2/2  lararplkrpelflslgirpgrillLyGppGvGKTtlakalakel........................g
00499192   2/2  ----kgkiigitGpsGsGKsTlaklLaellgatvgdvd.................gllvgvvfqd...df
00519582   2/2  ----kpkvilltGppGvGKttlarlLakllglpliidldalaellfgdvgglvvdli.............
00434401   1/2  ----------------------------------------------------------------------
00498532   2/2  --ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglprGsltliaGppGs
00405881   1/2  ----------------------------------------------------------------------
00513762   2/2  ------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvme.lg
00510562   2/2  --ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGglprGelvliaGppGs
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ---kPgkiigltGpsGsGKsTlarlLaelgvividgddltrelvaggglliglifqdfgl.felldrell
00478441   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00480442   2/2  ------rlivllGpsGaGKsTlaklLaellpglivisvgdttrepregevlgv.................
00510561   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00517692   2/2  felkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.............................
00521552   2/2  pelflslglrpgkgvlLvGppGtGKTtlaralagllga................................
00499191   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00437922   2/2  ....agklphlllvGppGvGKTtlaralarll.lgsgggvdvieldasdlrgvddlreligevlqalgll
00356411   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00410322   2/2  lelkkglkilllGlngaGKTTllnrllggef---------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00367292   2/2  lalkgldlflslglrpgrnvllyGppGtGKTtlaralanel........................gapfi
00472912   2/2  -mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl.................
00508672   2/2  slsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlge
00527262   2/2  edfigreeelkeleeal..pkivlltGprGsGKTtllkalakelgkpviyidlselsskgyv...dleel
00402371   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  lelkkglkvalvGrpgvGKSTLlnaLlga.........................................
00468952   2/2  --lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGglprGelvlivGp
00410531   1/2  ----------------------------------------------------------------------
00420942   2/2  lgirpgkgvllyGppGtGKTtlakalagel........................gapfiridg.......
00489632   2/2  ----MkgklillvGppGsGKtTlaraLaellglpfiridgddllrellgellgrgigf............
00482721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00402372   2/2  r..rpgrnvllvGppGvGKTtlaralagllvrssgpill..............dgvpfvrldaselle..
00499332   2/2  slslkkgklivltGppGsGKtTlakaLaerlglpfidtddllrepvigagtdigevfqdlllaggllvdd
00416171   1/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00403152   2/2  ----kglkivlvGdsgvGKTtLlnrllg..........................defpvsyiptigvdfy
00498531   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00394722   2/2  ealrrgpprnvlLvGppGvGKTtlakalakelaag.sgpilldgvpv.......................
00410532   2/2  lelkkglkillvGlngvGKTtllkrlag..........................................
00480252   2/2  slavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr......................p
00444381   1/2  ----------------------------------------------------------------------
00482662   2/2  ddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlel
00482661   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00401212   2/2  -elkrglnvgivGhvgaGKSTLlnaLlgll............ldtlkgelergitikigaasllldklai
00480441   1/2  ----------------------------------------------------------------------
00461622   2/2  ----mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevvergtelgklikdyfdpgalvpd..
00444382   2/2  rlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakll......gv...pfiri
00515352   2/2  --mn.gklivltGppGsGKtTlaraLaerlglpvistddllreavpg.gtdig.................
00482552   2/2  --everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyisteea
00527261   1/2  ----------------------------------------------------------------------
00418302   2/2  lplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr..........................
00516041   1/2  ----------------------------------------------------------------------
00476072   2/2  ----kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvllggpllerirellgegyllfdeal.
00478081   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00430122   2/2  rgrkglelgirpggnvllvGPpGvGKTtlakalagllfp...............................
00489391   1/2  ----------------------------------------------------------------------
00487062   2/2  ---ldMkkgklIvieGppGsGKtTlakaLaergargldvvviyepvdywaavgggdllrlirelllrlgf
00416172   2/2  lslaartgenvllvGppGtGKttlaralakllpr....................................
00378622   2/2  lllkkglkvllvGlpgvGKstllnrlageef---------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00533152   2/2  sldikkgklivltGppGsGKtTlarl--------------------------------------------
00473942   2/2  lalalallrgepgehvlLvGppGtGKTtlaralagllga...............................
00476651   1/2  ----------------------------------------------------------------------
00496062   2/2  -----gklivltGppGsGKtTlaklLaerlglpvistddllreevepggtdlgeifqalllagellfdde
00457852   2/2  ----PkgklivltGppGsGKtTlakaLaerlglpvistddllreavpggtrlgeviqdlfll.ggllffd
00489392   2/2  --lsikkgklivltGppGsGKtTlakaLaerlglpvistddllreavpg.gtdlgel.............
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  ..................................alldilldilkgktvalvGpsGvG------------
00462581   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  -----gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrreairelllgldlleilf......
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00511382   2/2  lllkpgglvlitGPtgsGKsttLlra--------------------------------------------
00471272   2/2  sliksllekllellkrlslklkkglkva------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478392   2/2  -msikkgklilltGppGsGKtTlaralaerlglpvidgddllrelvgeggrlgrdlfdedrllfrellid
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  -------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld....................
00493172   2/2  -----mgklivllGpsGaGKsTlaklLaekl---------------------------------------
00478132   2/2  -----kgkvivltGppGsGKtTlarl--------------------------------------------
00512062   2/2  ---kkkkgklivltGppGsGKtTlakaLaerlg.------------------------------------
00477562   2/2  ---kkpkvillvGppGsGKtTlaraL--------------------------------------------
00457882   2/2  ----mgklivltGppGsGKtTlaklLaerlglpvidtddllrelepdgtelgellqdlllaggllpdaiv
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  lelkkllkillvGlpgvGKTtllnrllgdef---------------------------------------
00420082   2/2  -smkkglrIaleGpsGvGKTTlaklLar------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  -----kgkiigltGpsGsGKsTlarlLaelglpvidtddlyrelvaggtplgerirell...........
00444822   2/2  -elkkllkvllvGlpgvGKttllnrllggef---------------------------------------
00480502   2/2  -----MgklillvGppGsGKtTlaralaellggvvvidgddlrralvggl....................
00493982   2/2  ----kpklilltGppGsGKttlaraL--------------------------------------------
00469162   2/2  ----------ieGppGsGKsTlaklLaerlgltglsv...lltredgfgtplgelirelllegfqdlilv
00378621   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  -----kpklilltGppGsGKttlara--------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----mlkgklillvGppGsGKtTlar--------------------------------------------
00476652   2/2  ..ggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll..........
00491902   2/2  ----lmkgkiilltGppGsGKttlak--------------------------------------------
00518512   2/2  ------klIvleGpsGsGKsTlaklLaeklglpf.idtddlliaadlgflileifealieggflledrvv
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  lllsligaklvkdllllvlkylpsllslldvlrpkvdfddii.leeakeelllellelplklpelfkrlg
00486922   2/2  ------mlivltGppGsGKtTlakaLaerlglpfistddllreavpggtd....................
00441252   2/2  kgipkknclllyGPpgtGKstlakalag------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  ..eallealr..agrpghvllvGppGtGKTtlaralanelprslp.glpfvrvnasdltdvglleellgk
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  dleealealaeaklpppkgvllyGpp--------------------------------------------
00459702   2/2  -----MpkvillvGppGsGKTTlaka--------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  -----apkli.ltGppGsGKttlaka--------------------------------------------
00444821   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
00422802   2/2  p...ltvrenlalglllallllglskaeararalellellplgldt.lldrlvgeLSgGqrqrvalAral
00379582   2/2  pgltvrenlalglllllllllllllllllalskaearervlellelvgldt.lldrlvgeLSgGqrqrva
00390412   2/2  lallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglvpqeh..dlfpllt
00490801   1/2  ----------------------------------------------------------------------
00490802   2/2  sGeilidgkdi.tglspqelrrlgglvlqdvllffltll.................lllaakeaalrall
00436072   2/2  gltvlenlalgllllgll.......ealaralellellglgdl..drlvseLSgGqrqrvalarallldp
00510252   2/2  ptsGeilidgkdi.tglspqelrrlgglvlqdvllffltll.................lllaakeaalra
00510251   1/2  ----------------------------------------------------------------------
00367902   2/2  llliirrlilrdgsgeilidgkdislldlrelrrligyvpqdp..alfpqltvlenlllglelrrkllde
00378982   2/2  alfpgltvrenlalgllla....glskaeaaaraaellellgldd.lldrlvgeLSgGqrqrvalarall
00379581   1/2  ----------------------------------------------------------------------
00500442   2/2  pgltvlenlllgll....llglslaeaaeralelllllgl.edlldrlvseLSgGqrqrvalarallldp
00475892   2/2  lt..vlenlllgll.....llglalkeaalralllllllgletlldrlvseLSgGqrqrvalarallldp
00458601   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00420702   2/2  alfpgltvrenlalglllag.....lskaeararalellellgldd.lldrlvgeLSgGqrqrvalaral
00475891   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  pgltvrenlalgllll....glskaeaaaralellellgldd.lldrlvgeLSgGqrqrvalarallldp
00509432   2/2  lsdglyllerselilrrlilkpg.sgeilingkdi.slldlrelrrligyvpqdpn..llfqltvlenll
00404102   2/2  fpgltvrenlalgll.........kaeararalellellgld.elldrlvgeLSgGqrqrvalarallll
00466972   2/2  .lfpgltvlenlllgllllglllllaakeaalrlellllllglet.lldrlvseLSgGqrqrvalarall
00458602   2/2  fltllenlllglallllllvlllllllllllllaakeaalralllllllgledlldrlpseLSgGqrqrv
00482202   2/2  psltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldp
00482201   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00436512   2/2  aelrrrigyvfqdpalpallrllalfpaltvaenlrfgl....glavlllldsatrlaqakreisalare
00420701   1/2  ----------------------------------------------------------------------
00530592   2/2  psltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldp
00372302   2/2  .................................llervgled.lldrlpstlsgGqrqrvai.ralatep
00482261   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475992   2/2  ..tvlenlllglllagellllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldp
00440862   2/2  lytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddglteldlellkllkelgkpvilvl
00482262   2/2  llpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArall
00372301   1/2  ----------------------------------------------------------------------
00466932   2/2  qepa..lfpgltveenlllglllrlllelllgrlelllllllllellallldllllllllllllllllll
00361212   2/2  peltvlenlalg..................rarellerlglail..drlpgeLSgGqqqrvaiaralald
00502742   2/2  psltvlenlalgll.....llglskaeaaaraaellellgledlldrlpseLSgGqrqrvalArallldp
00466971   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00488522   2/2  p...ltvlenlalg...............gedveellerlgl..dlldrlphqlsggqrqrvaiaralae
00469452   2/2  palfp...............................aeellelvgle.dlldrlpgelSgGqrq..aiar
00367482   2/2  ..................................rvdeiltrvglsdl.ldrgls.lsggerqrvalara
00367901   1/2  ----------------------------------------------------------------------
00485452   2/2  g.vfqdpa..llphltvpenldlglll..........eilervlellelvgldvvlldtyphelSgGqrq
00424962   2/2  lfprltvaenialgaeyf......rdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiaral
00509431   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00498252   2/2  esldll....rarrlgvvlqell..lfpeltveenl..................................
00361211   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00468692   2/2  ..elrelrrrigyvfqdp.alfpeltvlenlalgallag.....................lgl.aeylde
00379602   2/2  fpltvren.....................................................laralrqdP
00503372   2/2  qef.dlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliellldlsggelnrvalllq
00381442   2/2  pa..llpdltvlenlylglllalllaleegkivildgdreraeellellgldadlviilpasleellerl
00495372   2/2  glvfqteallpp..ltvrenlealgldlrglld......rerviellelvglee.lldrlprelsggnqr
00367481   1/2  ----------------------------------------------------------------------
00496112   2/2  fpel..tvlenlalgll...............................drlpgeldlSgglqrqrvaia.
00424961   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00464792   2/2  k.pdsgeivvyg...ligerprevrellglllelgvlf................................
00448932   2/2  ..gltvlenlalg.............eleararellellgledydvvliDtagrlrlpselsggqkqrva
00381441   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00422142   2/2  glslvirklre.viltledlglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpd.eg
00379601   1/2  ----------------------------------------------------------------------
00500612   2/2  qelgldpdltv.......................arerviellelvglle.lldrlprelkrsggqrqrv
00503371   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00457312   2/2  flnpgltvrenlaeplrll.klgkk...........llepvglp.evldryphelsgGqrQRv...rala
00468602   2/2  fpsltvldnlalar....dlleaa..kaagydvvlidtaglld..ldrlvgelsggqkqrvaiarala.a
00468691   1/2  ----------------------------------------------------------------------
00478412   2/2  ll..tvrengvalgllla....glskaeieervdlllelvgldd.lldrypdelsggqrqrvaiaralal
00437982   2/2  glfphltvlelvalgl...ggilveevrellkel....................lsgGqkqrvaiarala
00379961   1/2  ----------------------------------------------------------------------
00485932   2/2  ltv.lenlalg............gadlaeraeellellglegfdvvliDtagrgrrvgelsggqkqrvai
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00512892   2/2  ..tveellgllaelvgle..................vrgeleellktlikelsggekqrvalarallakp
00437981   1/2  ----------------------------------------------------------------------
00480472   2/2  llearraaigivfqdvdllltltva.enlllgldllllellkelkydpvilllnkidllddrllrraeae
00475372   2/2  .......................rrpsarellgllgellgldvl.vgarggdlsgglrqr..larallgd
00495032   2/2  .....................gldldell...erllvidllelvglle.lldrlprelsggqrqrvviDa
00532532   2/2  .lfpfltvlenvalgld.......glvdeedleraenllalvgl.eeipnrypselsgGqqqrv......
00475522   2/2  l..tvrenvilgllelaglsk...aealarvdellelvglddellldrlp....sggqqqeilrvaiall
00437941   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00414122   2/2  qtlglf..paltvlellalall................lredpdlilid...........sgGqkqrlal
00371632   2/2  sGsGKSTlarlLagllapesgglkvlligtDifylpa.eqlkrigllfq...kglpealdveell.....
00485931   1/2  ----------------------------------------------------------------------
00387202   2/2  lfldeileidglllvelregigyvfqdp..alfpeltvle------------------------------
00503742   2/2  .........kvvyvnvselldl............................kellrlllealglpppyq..
00475371   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00426052   2/2  p.ilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegldtl......aggggvvls
00457311   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00379962   2/2  alpasllesel...................................................lsggerqr
00405882   2/2  .................grqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqpvel
00414121   1/2  ----------------------------------------------------------------------
00462762   2/2  pfl.tvlenvllpllaagliv..........ivdgtlllvglrealrkll.gllsgGqkqrvadlvvlld
00477972   2/2  eltvagnflegaevr..gnlygts...rerveellea.gld.vlldidpqglsggqkqrlalaralilpp
00434402   2/2  al...........................drellreevlellglgev.vivdvydlsggerqr...aral
00475382   2/2  alfprl.tvlenvllgll..............................llgglvvildggvrqrlalara
00368502   2/2  vearlrelfeeaigyvfqdpalfpg..tvlenlalgllvseligappgyvggdlggllteavlealrikl
00437942   2/2  ..................................................pselsggerqrvliaralla
00493432   2/2  lfphlivagnllegaevhgllygtskerveealekgllvlldr..........dlsggqqlrvalaralv
00478411   1/2  ----------------------------------------------------------------------
00533502   2/2  lt.vrenlelllvfadr..ygvlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalaral
00368571   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00404192   2/2  .................................................delvsklsgglqeqrvaiafa
00489572   2/2  ............................................................lallelrntt
00368501   1/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00487022   2/2  ltvlelldnvllgleirgllk.....aerlervevllervgl...lldrippalsgGqgqrvildralls
00475521   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00478442   2/2  llevrglniaevle.....laglskaealkrvdlvlelvgld....drypyelsggerqrvailr..vll
00392702   2/2  ...........................................llgkyvgelsgglrqr..larallakp
00515512   2/2  fegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvllllv
00368572   2/2  nplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselg.....
00513252   2/2  .......................................................gqkqrvalleaalke
00356412   2/2  egadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi...........ilvlNKiDll
00515532   2/2  frslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdln...lfpsltvlenlanvpillvlnKiDl
00490731   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00451572   2/2  llelidegilvpdeiv...iellrealeeldad.gvildgfprllgqaelllsggkadlvifldaplevl
00532531   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00406782   2/2  .................................................llgkyvgelsgglrqrlalar
00464412   2/2  pdltvlenvalgry....gllglikealaegvivildrvglsdla...ypgflsggeqqrvaiarallpk
00462761   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  .............................................vlaeelgldvl.lgarggdlsgglr
00432181   1/2  ----------------------------------------------------------------------
00532472   2/2  qdldllp..llevlellaarleellerippa............................lsggqgqrvil
00532471   1/2  ----------------------------------------------------------------------
00496572   2/2  ldeltvlenlalgrylhl...glilaalaagvgvvldrvg.lsdlaygfprtlsglgqrqrvalarallk
00439862   2/2  eqlleraerlgldleellllgll.........................................siliad
00379262   2/2  ................gapfvevdaselteggyvgedlekr.irelfqearllvfltvlenirldaseyl
00470732   2/2  avgeleklgr...dlfqvaregglv..pdilfideidallrkgpdvildgagrtpeqlealldllee...
00437901   1/2  ----------------------------------------------------------------------
00432182   2/2  .....................................vliDtpGleefa........sggekqrvalala
00515511   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00484102   2/2  ....pvltvrenlalllrglpgysaeeleralellelagfdvilie..Gllelalplilelrelsdgqiq
00404191   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00386742   2/2  ...............................................pfvrldaselsggeklrgllara
00470731   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00477012   2/2  vvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlvDtPGlgsva
00496571   1/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00437902   2/2  apvieidaselrd...........................................vddlsgyvgelsgg
00499192   2/2  ylllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprllsggqrqrvaia.....d
00519582   2/2  .....................................................dleaverhlldiaeell
00434401   1/2  ----------------------------------------------------------------------
00498532   2/2  GKTtlalqlaanla..klggkvlyisteesleql..rarrlgldldellllpaltveellala.......
00405881   1/2  ----------------------------------------------------------------------
00513762   2/2  lgpn........................galvfaleellttldillealelleedydyiliDtpGglelr
00510562   2/2  GKTtlalqlaanla..aqggkvlyisteesleql..rarrlgldldrlllldaltv..............
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ielllenlalglal.....egvildalrrrllelldllgldvvilegplll.sgglrqrpdlvifldapp
00478441   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00480442   2/2  ............dyvfvdrelfeelivagnlledaivhgllygtskerieealda.glg.vlldgfprgl
00510561   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00517692   2/2  ...........................gtlllllgllsfllalvldslplerergitidvalarllldgr
00521552   2/2  .....................................................pfvrlsaselvgkyvge
00499191   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00437922   2/2  lgg...................................................................
00356411   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00367292   2/2  rvdaselleklvg..................................................egegrlr
00472912   2/2  ..............................................gllfedaleagfrqrladlirall
00508672   2/2  vfqelllagrl......vvldgtalglelrdelrellkeaglpll.vvfldaplevlleRdrrglypeel
00527262   2/2  lrela............................eelgellellkkllkklsellglsilglelilglsgg
00402371   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  .............................................dlaivsdipgttrdpilgvvlldgr
00468952   2/2  pGsGKTtlalqlaanla...klggkvlyidteesldqlr..arrlgldlddllllpaltveellala...
00410531   1/2  ----------------------------------------------------------------------
00420942   2/2  .........................................sellgkyvgelsgglrqllalara..akp
00489632   2/2  ........gfqqgdlledatvlenlalllldeidka..........ledggvvlldgfdrsqlqrlailr
00482721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00402372   2/2  ............................................fgkyvgafegglrqllglaraa..kp
00499332   2/2  ev..............................rrlllealdell.laggkvvildgfpggllqrealrrl
00416171   1/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00403152   2/2  vktveidgkklvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfenvlswleelrellgllll
00498531   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00394722   2/2  ....................................vrldlsellsvsdlvgelegglrgllteala.la
00410532   2/2  ...................................gefvdygptigvnfktvevdgvklviwDtaGqerf
00480252   2/2  sapeqlgilgellgvpvvgvltgldlagalrealell..........llegydvvliDtagglqrgllla
00444381   1/2  ----------------------------------------------------------------------
00482662   2/2  lekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgl
00482661   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00401212   2/2  vsdtpgttldpilgvleldg..................................................
00480441   1/2  ----------------------------------------------------------------------
00461622   2/2  llirlllerllfldeg....ggflldgfprtleqaeals.......................kpavlsgg
00444382   2/2  dgselte..kelvGe.......................................................
00515352   2/2  ...elfqdyllfpfltvdeni.......rglllealeellaag..kvvildglsggllqrvallrallrp
00482552   2/2  fsperlreralsl.........gldleelldrllvidatdlldllellerlrrllsegkvdlvviDslal
00527261   1/2  ----------------------------------------------------------------------
00418302   2/2  ...........................................................pfirvdaselt
00516041   1/2  ----------------------------------------------------------------------
00476072   2/2  .............................drellaallfglel.egalldglvygvlqdrllerllaagp
00478081   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00430122   2/2  ...................................................sgvpfirinlseltekllv
00489391   1/2  ----------------------------------------------------------------------
00487062   2/2  gepdafdnellgellealleggkivlsarraqllei..................................
00416172   2/2  ..............................................sgvpfvrvncsaltedlleselfg
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  ......................................................pfielsasdllgesdl
00476651   1/2  ----------------------------------------------------------------------
00496062   2/2  vlgll......................rerldelielllaggvvildgfpldlegalllrealarallpd
00457852   2/2  eldel..........................lkerieellaaggvildgfpldlegaealreallragpl
00489392   2/2  .......fqdlllegellfideiaelllealae.....................................
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  .....................................................eglllsdef.relleea
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478392   2/2  eidl...............................................................lla
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ...................ldeplgv.drerlrrvgelalllagggl.calvaddlaga.leellarala
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  rdlllelleelladgkgvildgfprdleqaeal...................................ra
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  ....gegyllpdealfrallaellfgdll..alalldgvvydrlrdell.aelsggqgdvliiegallle
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  .......................................idgllilfledeaalselvlevllealegg.
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  pdllvlellaan.......ragl.relikellaa.gkgvildrfplsrlayqlsggerqrlaidlegall
00378621   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ..................................................................esel
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  lsllayqgvildgg--------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  lkapkrrgvlLyGppGtGKTllakalakelgrl...pfirvn............................
00486922   2/2  .lgelfqelllegellfrdell......dlllevieellaaggvildgfplslegaqalrallrelgldp
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  llgaat................................................................
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSGRCN
00422802   2/2  lldpdllllDEptsgLDpetraellellrelak..gltvllvthdlsla..aladrilvlddGriv----
00379582   2/2  larallldpdllllDEptsgLDpetraellellrelake.gltvllvthdldeal---------------
00390412   2/2  vaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglkeeae----------
00490801   1/2  ----------------------------------------------------------------------
00490802   2/2  lllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraellell----------
00436072   2/2  dllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladrivvl---------------
00510252   2/2  ellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetraelle----------
00510251   1/2  ----------------------------------------------------------------------
00367902   2/2  llgllellalleellklleellkelevleaalaallkeeieeraeellellglgg---------------
00378982   2/2  ldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladri---------------
00379581   1/2  ----------------------------------------------------------------------
00500442   2/2  dllllDEPtsgLDpetraellellrelakelgltvllvthdlsealr-----------------------
00475892   2/2  kllllDEPtsgLDpetraellellrelake.gltvllvthdldealr-----------------------
00458601   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00420702   2/2  lldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr---------------
00475891   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  dllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvl---------------
00509432   2/2  lgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldg---------------
00404102   2/2  leelsldpdllllDEPtsglDpetraellellrelake.gltvllvthdldealr---------------
00466972   2/2  ldpdllllDEPtsgLDpetraellellrelake.gltvllvthdlde-----------------------
00458602   2/2  alArallldpdllllDEPtsgLDpetraellellrelake.gltvll-----------------------
00482202   2/2  kllllDEPtsgLDpetraellellrelak..gltvllvthdlsea..rladrilvlddGrivelgt----
00482201   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00436512   2/2  llervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllilDEpt------------------
00420701   1/2  ----------------------------------------------------------------------
00530592   2/2  kllllDEPtsgLDpetraellellrelak..gltvllvtHdlseal..ladrilvlddGr----------
00372302   2/2  sllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaal-----------------------
00482261   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475992   2/2  dllllDEPtsgLDpetraellellrelake.gltvllvtHdlsealr-----------------------
00440862   2/2  nkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvl-----------------------
00482262   2/2  ldpdllllDEPtsgLDpetraellellrelak..gltvllvthdlseal..ladrilvlddGrive----
00372301   1/2  ----------------------------------------------------------------------
00466932   2/2  lvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstLS---------------
00361212   2/2  pdllllDeptsalssrssendpetvaellellkelakelgvtv---------------------------
00502742   2/2  dllllDEPtsgLDpetraellellrelake.gltvllvthdldealr-----------------------
00466971   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00488522   2/2  elkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvthdldevar.la----
00469452   2/2  a.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgv--------------------------
00367482   2/2  latdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaalaa---------------
00367901   1/2  ----------------------------------------------------------------------
00485452   2/2  RvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthdlreae...adr----
00424962   2/2  lleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalkrlyPaidvllS------
00509431   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00498252   2/2  ..drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvl----
00361211   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00468692   2/2  lgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre..ilellrellkelgytvllv---------
00379602   2/2  dilllDEptsalda.......ellqallt..ghtvvlvthhlntaldladriivld--------------
00503372   2/2  gevdlllldepterldfldelagleeykgnyeellklleeleellkelekrlellekeleeleellerle
00381442   2/2  drrggelsggqkqRvalarallldpdl-------------------------------------------
00495372   2/2  qrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelg-------------------------
00367481   1/2  ----------------------------------------------------------------------
00496112   2/2  ..agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtvilvt--------------------
00424961   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00464792   2/2  aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEp-------------------
00448932   2/2  iaralaaplppevllldeptsglda.....lrellellre------------------------------
00381441   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00422142   2/2  riltiedp.............ieyvfqspnlfpl........................------------
00379601   1/2  ----------------------------------------------------------------------
00500612   2/2  viDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvllvthdlreveeladkrdr-----
00503371   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00457312   2/2  ldpdllilDeptsalgqpdpelrelldllifldadlgltlirlitrdlgeagrsadrvlgr---------
00468602   2/2  pevllldeptsgldalae..llelleel....gltvlvvtKlDgtak-----------------------
00468691   1/2  ----------------------------------------------------------------------
00478412   2/2  epelllldeptsaldplavvellelllglnee.ldiilalelllld------------------------
00437982   2/2  gdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilathdlsellpall-----------------
00379961   1/2  ----------------------------------------------------------------------
00485932   2/2  arallllldpelllldEptsglda..lrlllellkel....-----------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00512892   2/2  dvlllDEid.gldpdvleallelleel.krsgvtvilttndldel.eladriallrrgrivelgplseee
00437981   1/2  ----------------------------------------------------------------------
00480472   2/2  erieellelvgls---------------------------------------------------------
00475372   2/2  pdvlliDepgrgldpellallaelldllrelradlgllvvdathd-------------------------
00495032   2/2  lalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlrevegrleladrvvvlr----
00532532   2/2  .....illldEPtsgLd-----------------------------------------------------
00475522   2/2  ilpvllgralallpelllldeptsaldpdl----------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00414122   2/2  aralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselt----------
00371632   2/2  .................ellldlke...gledilvpvlsggqkqrlalaralvedpdvlilD--------
00485931   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00503742   2/2  ....lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltlil
00475371   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00426052   2/2  Ggqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerl------------
00457311   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00379962   2/2  valaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpagvtviaatn
00405882   2/2  lsggekqrlalarallgkpvilvlNKiDeptneldlellellee........lggtvvlvSahdgeglde
00414121   1/2  ----------------------------------------------------------------------
00462762   2/2  adpevllaReptrgldpeteeeleellerleereplyg.ad-----------------------------
00477972   2/2  sllrgldep.ealdarle.raleellelae..gfdvvivnhdleealelldril----------------
00434402   2/2  asgpdvlilDgptlgldv.............lldlpdlvifvdhdlevalerrlkrlgrsleeiie----
00475382   2/2  llldpdvllldepllll-----------------------------------------------------
00368502   2/2  vegelgfrelerevlldlplhdasviallgggrelrdgellkalk..eaeaeellellglk.dlllrkps
00437942   2/2  dpkvlllDEi.daldpeaqnaLlklleelpk..gvtvilttnrl--------------------------
00493432   2/2  vfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeel-----------
00478411   1/2  ----------------------------------------------------------------------
00533502   2/2  vvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylellekadr----------------
00368571   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00404192   2/2  larkpdllllDEidalgldpelqeellelldelaer.gvtliltt-------------------------
00489572   2/2  eagaasgsrdkgllgklkpetraelldllre.egttilvvth.ldeaer.aDrvavldd.Gtpee-----
00368501   1/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00487022   2/2  elayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpeelleRllkRgre-------
00475521   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00478442   2/2  pklllpdepgrnldvlievavlnlilkllgidallelvdrl-----------------------------
00392702   2/2  svlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpeeldpallrpgrfdr
00515512   2/2  glfdll............dglpselsggqkq---------------------------------------
00368572   2/2  ....lrdladrleklvagglagllegaektaasilellrkllallld-----------------------
00513252   2/2  gylvvvDet..gldraqrlellelardlgrpv..lviflatspevlierlldrvllldegslvdlg----
00356412   2/2  eekiveellellgleykgd.rdpeelsggqkqrvalara-------------------------------
00515532   2/2  leakeraeellellgl.gdlldklpselsgGqkq------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00451572   2/2  leRllkrddekilkrleeqkqrvaiarallkkpailild-------------------------------
00532531   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00406782   2/2  a..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvt-----------------
00464412   2/2  pdlvllldepteelde..RllkRg...rllekleyikkrlehylela-----------------------
00462761   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  qr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlglea---------
00432181   1/2  ----------------------------------------------------------------------
00532472   2/2  drslysrpavlllllyvdeplsgldvelreelrdlleslllvlpl-------------------------
00532471   1/2  ----------------------------------------------------------------------
00496572   2/2  pdlvifldeppteeldeRlrkrl....................rlgdteevlehrl--------------
00439862   2/2  plglsgeellrvllalalelkpdlliiDeltalldaervrelrellr-----------------------
00379262   2/2  ekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevg
00470732   2/2  .lgrpvvviilttnrevlldral.rRpgrllldep..---------------------------------
00437901   1/2  ----------------------------------------------------------------------
00432182   2/2  llreadvlllvvdadeptsfld------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00484102   2/2  rvaparallrdpllllldedtvvldkvdlasildllle--------------------------------
00404191   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00386742   2/2  la.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsg-----------------
00470731   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00477012   2/2  ...vvdqlsggqkqrvalarallknpdtlillved..and------------------------------
00496571   1/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00437902   2/2  eklrellaealteavlkgkpsvlllDEi.daldpdvlnallkl---------------------------
00499192   2/2  pdvlildgptllldpe....lrpladlv------------------------------------------
00519582   2/2  engeilildeptvgldskd...ildelakilkevnfelifithdedelrerial----------------
00434401   1/2  ----------------------------------------------------------------------
00498532   2/2  ................................erllsggkpdlvv-------------------------
00405881   1/2  ----------------------------------------------------------------------
00513762   2/2  allalllaiaral.aadeillvddptsgldaetqleilelllelllklgip.iilvlnKlDllse-----
00510562   2/2  ........................eellalaerllsggkv------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  evlleRllkRggldeetiekrlelylelaplygaadividnd.lsleevvdrilalle------------
00478441   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00480442   2/2  sqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelg--------------
00510561   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00517692   2/2  killlDtP--------------------------------------------------------------
00521552   2/2  legglrqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrl-----------------
00499191   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00437922   2/2  kpdvlllDEi.drldpdaqnallklleel..pagvtlilttnr---------------------------
00356411   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00367292   2/2  galaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvlsg-----------------
00472912   2/2  akgkvvild..gtglsreareellellkelg...pvlvifldadpevlleRllkrgrallreevldrlle
00508672   2/2  sgglkqrvaiarplelaaepdlvi...dtsaldp.-----------------------------------
00527262   2/2  dleelleelaellkklgkpvililDEiqslldvsskelleaLlrlldegknvtiiltgsdlglld-----
00402371   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  dllllDtPGlidfaseptnlldlei---------------------------------------------
00468952   2/2  ....................................erllsggkp-------------------------
00410531   1/2  ----------------------------------------------------------------------
00420942   2/2  silllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrpeeldpallrpgRfdl
00489632   2/2  allddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvivtddl-------------
00482721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00402372   2/2  gvlflDEidsllgarggsgvdpevqnaLlrlleegnvrviaatnrpelvklgeldpa-------------
00499332   2/2  lprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdlie----------------
00416171   1/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00403152   2/2  egvpillvgnKlDlp....tnerdvsleealelalelgllpvievSaktgegvdelfellv---------
00498531   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00394722   2/2  kpsvlflDEidrlldardsesslevlnaLlrlledgnvlviat---------------------------
00410532   2/2  rsllarylrgadgillvvdatdglsfeevaklleellglaglegvp------------------------
00480252   2/2  laladlllvllldepllvldatagtellelakgllealgldgvvl-------------------------
00444381   1/2  ----------------------------------------------------------------------
00482662   2/2  lLyGPpGtGKTtlakalanel......ggpvi..........................------------
00482661   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00401212   2/2  ....pkll--------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00461622   2/2  rkqrlalaralavdpe.lildgrllgr.------------------------------------------
00444382   2/2  ..segailsggfkqrvgia..lladpgilflDEidkllddrgeaegggdvsregvqnaLlrlleegelli
00515352   2/2  dlvifldapleel---------------------------------------------------------
00482552   2/2  laraelldepllgldarelrellrlLkrlakelgvtviltsqltrevedradkrpdlsdlrgggaleq--
00527261   1/2  ----------------------------------------------------------------------
00418302   2/2  eaelvGye--------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00476072   2/2  dvlildgpl.lldvellplpdlvifldapp----------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00430122   2/2  selighppgyvGedelgvlfeaarkappsvlllDE.idkldpdvlnaLlqlleegevtdlggrvvdlsn-
00489391   1/2  ----------------------------------------------------------------------
00487062   2/2  ...................rlirpllaeg-----------------------------------------
00416172   2/2  hekgafgg--------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  rggfkqa.akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvvelll----------------
00476651   1/2  ----------------------------------------------------------------------
00496062   2/2  l.vifldapl------------------------------------------------------------
00457852   2/2  pdlvifldap------------------------------------------------------------
00489392   2/2  aegkvvildgtg..ldieqrealrelll------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  lalladg.dvvilDgfgrlldarqllee------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478392   2/2  kgkvvildgtnlsealdealrrllr..........pdlvifldapleelleRll----------------
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ggpdviliEgagllplpliellrdlldlvvlvvld.givllvdaidrleaadllvln-------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  llaelglppdlvifldaplevlleRllkrgddpeealekrlklye-------------------------
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  pgllplpdlvifldappevlle------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  gnpdvvildgt..nlleedrellrellkrlgrpdlvifldapleellerllkrgredlslevllkrl---
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  lerlllde--------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  fgeekeaflgallerlgklalagggtvlflDEidkldpdvqnaLlrllee.......ppsnvrvilttnr
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  .........................................................nl-----------
00486922   2/2  dlvifldapp------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  ....fllakpgvlflDE.idkldpdvqnaLlrlle..elpsnvrviattnrpleldpallsRflvielpp
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           N---------------------------------------------------------------------
00422802   2/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00503372   2/2  ale-------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00512892   2/2  l---------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00503742   2/2  t---------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00379962   2/2  dd--------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00392702   2/2  i---------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00379262   2/2  el--------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00472912   2/2  v---------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00420942   2/2  v---------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------