[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69275.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  60::279  1.9e-63 44.0% 0047268 00472681 1/1                                           
  56::276  8.8e-62 43.9% 0041525 00415251 1/1                                           
  63::282  1.8e-58 46.2% 0038911 00389111 1/1                                           
  63::280  4.7e-58 47.6% 0049351 00493511 1/1                                           
  65::276  9.9e-58 46.8% 0041438 00414381 1/1                                           
  71::285  1.4e-57 49.8% 0038910 00389101 1/1                                           
  17::275  7.5e-53 38.8% 0043774 00437741 1/1                                           
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYYQEVTFLPVID
00472681   1/1  -----------------------------------------------------------lrivdlldpva
00415251   1/1  -------------------------------------------------------yavqlllvrlllapl
00389111   1/1  --------------------------------------------------------------vrllapl.
00493511   1/1  --------------------------------------------------------------vrlllapl
00414381   1/1  ----------------------------------------------------------------lllalg
00389101   1/1  ----------------------------------------------------------------------
00437741   1/1  ----------------lslltiealadaLlearregkpi...ppltdalppldledAyaiqlalvellla


                         -         -         *         -         -         -         -:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
00472681   1/1  spgkiicvglnyrdhaaelgpnvpelPvlflkrasslvgpgdpivrPlGqllpddaeepvfglskrldyE
00415251   1/1  ppvkivcvglnyaahaeelgvdlpdepvlFlkpasalvgpgdpiplpsgsiqldyEaElavvigkdlrgv
00389111   1/1  ppgkivcvglnyaahakelg..velpeePvfflkpassvvgpgdpiplpagseqldyEaElavvigkdgr
00493511   1/1  ppgkiicvglnyaahaeelgvdvpeePvlFlkpasslvgpgdpiplpagsllldyEvELavvigkggrnv
00414381   1/1  prvkivcvglnyaahakelgvdvpdlPvlFlkpasslvgpgdpiplplgqllpealegleedgadseepv
00389101   1/1  ppgkiicvglnyadhakelgltsgavlalllpeePvfflkpasslvgpgdpiplpalse.ldyEaELavv
00437741   1/1  vgepvvgikvglnyaahakelg..pdePvlflkpadavvgdgapiplppli.qpdyEvElavvlgkdlpg


                         +         -         -         -         -         *         -:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
00472681   1/1  lELavvigkglelgrnisvedaldhifGytllnDvsaRdlqarelvglgwflaKsfd..tplgPwivtad
00415251   1/1  svedaldyvagytlgnDvsardlqlrlkakgldwvadkafdgfaplGpwivtadelgdladlgltlrvng
00389111   1/1  gvsaedaldyvagytlgnDvsardlqkkiglpwtlakgfdgfaplGpwivtldelgdladlgltlrvnge
00493511   1/1  saedaldavagytlanDvsardlqleekakglpwlagKsfdgfaplGpwivtadel.dpadlrlrlrvng
00414381   1/1  lsasiqldyEaElavvigkdgrnvslldvedAldyvagytlinDvsardlqleekkkglpwtlaknfdtf
00389101   1/1  igkdgrgvsvedaldyvagytlgnDvsardlqkglpwtlaksfdgsaplGpwivt....pdpanlrltlr
00437741   1/1  rdvtledaldavagytpaleitdrrlqdwkiklldwladkafdgslvlGpwivtldal.dlanlglvltv


                         -         -         -         +         -         -         -:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRY
00472681   1/1  elepfrvagpeqdpeplpylddeggdpldlrlelrvngelrgeatllqdgntsdmifsvaeliahlsrn-
00415251   1/1  elvqdgntadmifspaelvaylsngmtLeaGdviltGTpsgvg.......plkpGdvveveieglg----
00389111   1/1  vvqdgntadmifspaeliahlsrgmtLepGdliltGTpsgvg.......plkpGdvveveieglgtlsnt
00493511   1/1  elvqdgntsdmifsvaeliaylsngmtLepGdviltGTpsgvg.......plkpGdvveleieglgtlsn
00414381   1/1  aplgpwvvtadelgparldlanlglrlrvngelvqdgntadmlfspaeliahlsngmtLepGdlil----
00389101   1/1  vngevvqdgntadmifsvaeliaylsngmtLrpGdviltGTpagvg.......plkpGdvveveieglgt
00437741   1/1  nGevvqtgntaamlgdpaelvawlsnflaalgitLeaGdviltGtpagvg.......plkpGdvv-----


                         -         *         -         -         -         -         +:350
query           LTSSVSWHDGRK----------------------------------------------------------
00472681   1/1  ----------------------------------------------------------------------
00415251   1/1  ----------------------------------------------------------------------
00389111   1/1  vv--------------------------------------------------------------------
00493511   1/1  ----------------------------------------------------------------------
00414381   1/1  ----------------------------------------------------------------------
00389101   1/1  lrntv-----------------------------------------------------------------
00437741   1/1  ----------------------------------------------------------------------