[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69484.1


[Show Plain Result]

## Summary of Sequence Search
   1::648
   7::222  2.7e-71 43.6% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   5::229  3.4e-68 44.7% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   4::247  4.1e-67 40.1% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   1::240  5.4e-67 43.2% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   4::233  8.4e-67 43.8% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   5::229  1.3e-64 45.3% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   4::233  1.4e-64 45.1% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   5::236  1.6e-64 43.9% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
  19::244  3.2e-64 43.0% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   5::236  3.5e-64 43.9% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::233  5.3e-64 43.7% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  19::229  4.7e-63 42.9% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   3::236    1e-62 40.9% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   2::247  5.5e-62 42.4% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
  12::230  6.1e-62 41.6% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   4::233  1.1e-61 44.1% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   5::233  2.8e-61 43.4% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   4::246  4.9e-61 42.5% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   3::236  3.8e-60 44.6% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   6::242  6.4e-60 41.8% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   4::243  6.5e-60 44.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   3::236  1.1e-59 44.9% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   3::218    2e-58 43.7% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   4::231  4.7e-57 45.9% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   3::223  1.3e-55 46.4% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  11::234  5.5e-55 43.2% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   4::229  6.1e-55 42.1% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   4::235  1.2e-51 45.5% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::235  3.6e-51 43.2% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::236  4.1e-51 37.8% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   4::212  2.4e-50 40.4% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   4::231  4.4e-49 46.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   1::224  8.1e-49 38.8% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   1::229  1.8e-48 39.9% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   6::245  8.9e-47 38.9% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  23::224  1.7e-46 38.7% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  21::247  9.9e-46 38.4% 0053253 00532531 1/1   arboxykinase-like                       
   1::234  1.9e-45 44.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   1::222  2.3e-45 40.0% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   4::230  4.5e-45 42.7% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  24::240  4.8e-45 45.3% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  34::230  1.9e-44 41.7% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  34::191  2.5e-44 45.3% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  29::239  9.4e-44 39.8% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  26::240  1.7e-42 36.3% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  18::227  5.8e-42 37.9% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  28::176  1.1e-41 46.3% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  20::209  3.2e-41 38.3% 0047841 00478411 1/1   arboxykinase-like                       
   1::222  6.3e-40 37.2% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::221  1.2e-39 40.0% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  23::266    2e-39 35.4% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   4::225  6.5e-39 40.1% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  20::195  2.9e-38 44.3% 0047552 00475521 1/1   arboxykinase-like                       
  32::221  1.7e-37 37.7% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   4::228  8.3e-37 37.4% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  33::197  2.5e-35 42.3% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   4::237  3.4e-35 34.9% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  34::209  1.2e-34 39.7% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  32::218  9.8e-34 38.6% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  31::215  8.8e-33 39.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  35::240  1.1e-32 32.4% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  19::209  1.7e-32 38.2% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   1::134  4.3e-32 39.5% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   7::221  4.4e-32 37.1% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  32::226    5e-32 37.9% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  20::206  5.9e-32 36.5% 0047844 00478441 1/1   arboxykinase-like                       
  12::225  7.2e-31 32.2% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  33::194    1e-30 38.9% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  34::217  1.3e-30 34.7% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   7::202  3.7e-29 38.6% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  26::265  1.5e-28 30.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  33::202  4.9e-28 35.8% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  25::226  1.3e-27 35.5% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  25::198  1.5e-27 38.0% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   6::304  4.6e-27 28.9% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  33::237  2.2e-26 30.8% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  29::202  3.5e-26 35.0% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
   8::230  1.5e-25 30.3% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  34::221  3.6e-25 34.6% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  32::216  1.3e-24 35.5% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  26::223  1.6e-24 31.9% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   1::229  1.7e-24 38.3% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  18::222  1.7e-23 27.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   2::217    2e-23 26.9% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  26::223  2.9e-23 28.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  33::218  3.3e-23 34.2% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  34::219  5.9e-23 29.4% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   5::233  1.1e-21 32.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  26::223  1.8e-21 26.1% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  34::209    7e-21 35.9% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  31::220  1.2e-20 27.6% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  34::231  1.8e-20 32.7% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  20::237  1.9e-18 31.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
   2::219    2e-18 34.9% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  36::222  2.9e-18 31.2% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  21::221  3.2e-18 37.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  26::229  4.2e-17 25.7% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  35::221    9e-17 25.1% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  28::200  2.7e-16 43.5% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  35::220  6.2e-16 26.4% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  23::217  3.5e-15 29.9% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  28::221  1.1e-14 26.8% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   6::233  1.5e-14 34.2% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  18::204  1.8e-14 30.2% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  27::216  1.8e-14 31.6% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  21::220    2e-14 30.0% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
   7::204  2.3e-14 35.7% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  34::222  2.7e-14 28.0% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   1::233  9.8e-14 28.7% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  12::217  1.7e-13 26.4% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  23::213  3.9e-13 25.2% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  28::217  5.6e-13 30.2% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
   2::204  3.8e-12 32.1% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   5::204  1.4e-11 33.6% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  25::233  1.9e-11 32.2% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  28::221  2.4e-11 25.3% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  30::223  3.5e-11 28.9% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  27::216  3.6e-11 33.0% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  20::204    4e-11 27.4% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   8::204  4.7e-11 27.3% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  33::224    6e-11 26.8% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  34::259  6.2e-11 24.0% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  34::218    4e-10 29.3% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  32::210  4.2e-10 27.6% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  34::228  1.3e-09 25.2% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  30::219  7.2e-09 26.4% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  33::248  7.4e-09 24.0% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  36::223  1.1e-08 29.6% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  23::76   2.2e-08 46.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
   2::264  4.4e-08 22.4% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  29::209  7.7e-08 26.7% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  31::202  9.5e-08 24.6% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  22::202  1.1e-07 23.1% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  30::216  1.8e-07 27.5% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  35::229  1.8e-07 28.2% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  34::222  2.3e-07 26.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
   3::74   4.4e-07 38.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  18::54   1.5e-06 37.8% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  34::218    3e-06 26.5% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  36::217  7.8e-06 23.4% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  25::76     1e-05 30.8% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  34::218  1.8e-05 23.7% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  34::225  2.2e-05 23.2% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  34::218  3.5e-05 22.8% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  33::195    4e-05 21.5% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  19::54   6.2e-05 41.7% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  30::204   0.0001 26.6% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  34::224   0.0001 22.4% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  30::54   0.00012 40.0% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  20::54    0.0004 42.9% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  32::54   0.00045 39.1% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  33::54   0.00065 42.9% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
  37::74   0.00073 37.8% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
  33::54   0.00074 45.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  33::54   0.00091 54.5% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
  11::92   0.00097 22.1% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
   1::648


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR
00390411   1/1  ------Mknlslrygn....fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgkls
00422801   1/1  ----llllllallllllllllldpllelenlsksyggrl..vlalkdvsltvkpgeivalvGpnGsGKST
00379581   1/1  ---lepllevenlsksy....ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeill
00440861   1/1  Mpllslgepllelenlsksy....ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsG
00378981   1/1  ---lpllelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilld
00367901   1/1  ----lelknlslsyg.....ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsg
00420701   1/1  ---lpllelenlsksyp..gggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilld
00490801   1/1  ----llllllllalllelleeeeellllllalllllgdpllelenlsksygg....vpalkdvsltikpG
00475891   1/1  ------------------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkll
00510251   1/1  ----lllllllllaeellelleeeelllllllllllllgdpllelenlsksy....ggvpalkdvsltik
00509431   1/1  M...lelknlslsnfr......vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllra
00466931   1/1  ------------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpds
00458601   1/1  --lllevenlsksygg....vlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00482201   1/1  -llllelknlsksygg....vlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00466971   1/1  -----------llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00500441   1/1  ---lllelllelknlsksygg....vlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGei
00425571   1/1  ----lelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgl
00530591   1/1  ---llllllaleelpllgelllevknlsksyg....gvlalkdvsltikpgeivalvGpnGsGKSTllkl
00482261   1/1  --lllevenlsksygg....vlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00404101   1/1  -----elenlsksygg....vlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgl
00475991   1/1  ---lllaaelpelgelllevvnlsksyg....gvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00502741   1/1  --lllevenlsksygg....vlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00436071   1/1  --pllelenlsksygg.....lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgl
00361211   1/1  ---plellgepllelenlsksyg....gitalddvslgirkGeivllvGpsGsGKStllrnllagllapt
00469451   1/1  --allelenlskiyggvp...kalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeilll
00485451   1/1  ----------skiy..gd...ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpll
00424961   1/1  ---lgepldglgplrpapgllelenvsksygtg....ialidlslpigkGervalvGpsGaGKttLlrli
00372301   1/1  ---yvlPllsdgmpllelenlrkpy....ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglll
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtg....ialidvsltig
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytg....ipal.dvslglgGlppGeivlllGpsGs
00436511   1/1  ---ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltik
00367481   1/1  ---yvrPelldepllelengrhPllsksyg....gkvvlndislsip.gellvitGPngsGKSTllrala
00495371   1/1  esalellleledltklstg....ikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...e
00488521   1/1  lllllalelllevenlristgike....ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppds
00496111   1/1  -----elenltklytg....ikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvlii
00503371   1/1  ----------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiag
00532531   1/1  --------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidgg
00379601   1/1  ledllelenlsfsy....ggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegp
00500611   1/1  pgllsllelllelenltklptg....ipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapds
00422141   1/1  ---dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielif
00448931   1/1  -----------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvga
00457311   1/1  ---------------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgviv
00381441   1/1  ---------------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigsltt
00485931   1/1  ----------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvga
00468601   1/1  -------------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllga
00462761   1/1  -----------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvll
00480471   1/1  ---------------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdf
00478411   1/1  -------------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg
00495031   1/1  lsalellleledltkistg....ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglglip
00437981   1/1  lveklrpknldkvi....gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkill
00475371   1/1  ----------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlliga
00464791   1/1  ---lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi....vlidvsl
00475521   1/1  -------------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.
00426051   1/1  -------------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilr
00371631   1/1  ---mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrl
00515531   1/1  --------------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsg
00368501   1/1  ---kerllllelrnvllddviGqe..eakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTt
00475381   1/1  ---------------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvd
00477971   1/1  -------------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgt
00487021   1/1  ------------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidt
00512891   1/1  ----------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgr
00434401   1/1  ------------------ggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidl
00387201   1/1  mssgepllevenlskry....ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsp
00379961   1/1  ------yrpvdfddivGqee..alralslalaagppegvllvGppGtGKstlaralagllppdsgrivlv
00414121   1/1  -------------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdf
00478441   1/1  -------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd
00477011   1/1  -----------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtr
00515511   1/1  --------------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigpteg
00533501   1/1  ---------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlld
00356411   1/1  ------lknlsksyg....ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegti
00490731   1/1  -------------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllida
00484101   1/1  --------------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigl
00368571   1/1  ------------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldl
00508671   1/1  ------------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeep
00503741   1/1  -----fifldlrplallplpdrlvgrdeeiealskalgg......aldgvslsiepggivllvGppGvGK
00493431   1/1  --------------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggt
00451571   1/1  ----------------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgd
00489571   1/1  -------rvknlsksyggk....talddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.......
00496571   1/1  ---------------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldt
00464411   1/1  -------------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltg
00468951   1/1  -------------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgi
00437941   1/1  lrplveklrpknlddvy.gqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvl
00470731   1/1  -----------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlarala
00379261   1/1  -drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaral
00510561   1/1  -------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaL
00532471   1/1  --------------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddl
00498811   1/1  ---------------------------------kPgkiigltGpsGsGKsTlarlLael.....gvivid
00404191   1/1  ----vtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa
00498531   1/1  -------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaL
00499191   1/1  ---------------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd...
00439861   1/1  ------------------------------kleeveristgipeldellgGglpkgslilitGppGsGKT
00405881   1/1  ---------------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttld
00444381   1/1  -------------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddlig
00406781   1/1  -plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagel
00489631   1/1  -----------------------------------MkgklillvGppGsGKtTlaraLaellglpf...i
00392701   1/1  --------------------rlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvda...
00480251   1/1  -------------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllid
00480441   1/1  ----------------------------------rlivllGpsGaGKsTlaklLaell.p..glivisvg
00432181   1/1  ---------------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttr
00513761   1/1  ----------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidl
00394721   1/1  ----------------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilld
00499331   1/1  ---------------------------PslslkkgklivltGppGsGKtTlakaLaerlglpfidtddll
00386741   1/1  -----klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelga.....
00402371   1/1  -----------------eealeallealrr.rpgrnvllvGppGvGKTtlaralagllvrssgpilldgv
00517691   1/1  --------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.
00513251   1/1  --------------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidad
00420941   1/1  ------lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalage
00515351   1/1  ---------------------------------mngklivltGppGsGKtTlaraLaerlglpvistddl
00437921   1/1  lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvi
00416171   1/1  -----------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvnc
00527261   1/1  ----------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtll
00511381   1/1  ---------------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilv..
00521551   1/1  -plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll
00473941   1/1  ----eklrpvllddvvgqeevk..kalllalalallrgepgehvlLvGppGtGKTtlaralagllga...
00437901   1/1  ------------------------lflslgirpgrillLyGppGvGKTtlakalakel..........ga
00533151   1/1  ---------------------------MsldikkgklivltGppGsGKtTlarlLaerlglpfistddll
00472911   1/1  -----------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddll
00409841   1/1  --------------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttr
00430121   1/1  -------------------qeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllf
00367291   1/1  -------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel.
00461621   1/1  --------------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly
00478081   1/1  ---------------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvi..
00496061   1/1  ---------------------------------gklivltGppGsGKtTlaklLaerlglpvistddllr
00487061   1/1  -------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvv
00476071   1/1  ---------------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltr
00478391   1/1  -----------------------------msikkgklilltGppGsGKtTlaralaerl.....glpvid
00519581   1/1  --------------------------------kpkvilltGppGvGKttlarlLakllglpliidldala
00509891   1/1  -----------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavi
00495771   1/1  ----------------------alldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdgg
00418301   1/1  -drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaral
00489391   1/1  ----------------------------lsikkgklivltGppGsGKtTlakaLaerlglpvistddllr
00482551   1/1  ------------------------------everlstgipalDellgGglppgslvliaGppGsGKTtla
00410531   1/1  ---------------------gelknlslelkkglkillvGlngvGKTtllkrlag..............
00401211   1/1  -----------------------------elkrglnvgivGhvgaGKSTLlnaLlgll............
00469161   1/1  ----------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltre
00457851   1/1  ---------------------------------PkgklivltGppGsGKtTlakaLaerlglpvistddl
00471271   1/1  --prailelesliksl..lekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaevgptpgt
00410321   1/1  -----------------yggllllkdlslelkkglkilllGlngaGKTTllnrl----------------
00477561   1/1  ---------------------------------kkpkvillvGppGsGKtTlaraLakrlael.......
00480501   1/1  -----------------------------------MgklillvGppGsGKtTlaralaell.........
00414001   1/1  ------------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftTl
00478131   1/1  ---------------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvid
00516041   1/1  ---------------------------------mlkgklillvGppGsGKtTlaralaeel....glpfv
00477721   1/1  ---------------------------------kpklilltGppGsGKttlaraLaeel...........
00378841   1/1  --------------------------------kelkillvGdsgvGKstLlnrllgde.fiveyiptigv
00378621   1/1  ------------------glklllrrlslllkkglkvllvGlpgvGKstllnrl----------------
00482661   1/1  -----------------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvd
00482721   1/1  ---------------------------------kgkiigltGpsGsGKsTlarlLael.....glpvidt
00420081   1/1  -----------------------------smkkglrIaleGpsGvGKTTlaklL----------------
00488191   1/1  -------------------fllsllrrlslllkrllkvalvGlpgvGKStLlna----------------
00512061   1/1  -------------------------------kkkkgklivltGppGsGKtTlak----------------
00479331   1/1  --------------------------------apkli.ltGppGsGKttlakaL----------------
00523461   1/1  ------------------------------------akvalvGlpnvGKStLlnallgdk.aivsdipgi
00493171   1/1  --------------------------------mgklivllGpsGaGKsTlaklL----------------
00475471   1/1  --------------------------------mglkvalvGlPNVGKSTLlNaL----------------
00470231   1/1  ----------elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrl...........kivs


                         -         -         *         -         -         -         -:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKKRQARARELLLRLGLSDRVDY
00390411   1/1  dlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnl
00422801   1/1  llkllagllkptsGeilldgldilalslae....lrrrigyvfqdpalfp.ltvrenlalglllallllg
00379581   1/1  dglditalslael...rrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearer
00440861   1/1  sGKStLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleea
00378981   1/1  gldllllslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellglddll
00367901   1/1  lidlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislld...lrelrr.ligy
00420701   1/1  gldllllslaellalr.rgigyvfqdpalfpgltvrenlalglllaglskaeararalellellglddll
00490801   1/1  eivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.....
00475891   1/1  agllkptsGeilldgkdilgls...llellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalr
00510251   1/1  pGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll...
00509431   1/1  gglsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi...slldlr
00466931   1/1  Geilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllll
00458601   1/1  ditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrallll
00482201   1/1  dilglslkel.....rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgle
00466971   1/1  Geilldgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlell
00500441   1/1  lldgkdildlsl......lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgle
00425571   1/1  dllalsl......lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellglddlldr
00530591   1/1  lagllkptsGeilldgkditdlslkel.....rgigyvvqqdallpsltvlenlllgllllgllllllaa
00482261   1/1  dildlslael.....rgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgl
00404101   1/1  dltalslael....rrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgldelldr
00475991   1/1  lkptsGeilldgkdildlslael.....rgigyvfqqdallpsltvlenlllglllagellllllaakea
00502741   1/1  dilglslael.....rgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellellgledlldr
00436071   1/1  dlla.........lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl.dr
00361211   1/1  ggsvlldgleisalslaer...lragigyvfqdlalfpeltvlenlalg.............rareller
00469451   1/1  dgkdvlylsleesleqlrrrigyvfqdpalfp.........................aeellelvgledl
00485451   1/1  ltggkvlvigldifrlsarelrkrig......vfqdpallphltvpenldlglll......eilervlel
00424961   1/1  aglldpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfrdegadvl
00372301   1/1  pasggilvdgedlr..............igyvfq..................................ll
00468691   1/1  rGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre......lrrrigyvfqdpalfpelt
00498251   1/1  GKTtLalrllagllkpgggvvyidgeesldll.......rarrlgvvlqelllfpeltveenl.......
00436511   1/1  kGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpa
00367481   1/1  glllpasggilvpgedalll................................................rv
00495371   1/1  vlvdgldltglspa......rggiglvfqteallppltvrenlealgldlrglld...rerviellelvg
00488521   1/1  Gei...................ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerl
00496111   1/1  gle...lsaeelrerr.rrigyvfqepalfpeltvlenlalgll..........................
00503371   1/1  llgpdsgeirldgkdlliylsdlir..rgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgr
00532531   1/1  dinleggfyakaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgleeip
00379601   1/1  del..........lrnkigyvfQdpvlfp.ltvren..................................
00500611   1/1  geillggkvl.yislee..slrrrrigmvfqelgldpdltv.................arerviellelv
00422141   1/1  ldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltled
00448931   1/1  diarla.......areqlgivfqdp....gltvlenlalg.........eleararellellgledydvv
00457311   1/1  idgddlyklsreelrklr.rrigmvfqdpalflnpgltvrenlaeplrllklgkk........llepvgl
00381441   1/1  rlprlgevdgvdltfls........reeigyvfqepallpdltvlenlylglllalllaleegkivildg
00485931   1/1  di.............rrigavpqlpvlfprltvlenlalg.......gadlaeraeellellglegfdvv
00468601   1/1  Diyraaaae.....rlgigavpqdvplfpsltvldnlalar..dlleaakaagydvvlidtaglld.ldr
00462761   1/1  dgddlr..........lglliglvfqdpdllpfltvlenvllpllaagliv.....ivdgtlllvglrea
00480471   1/1  ilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkel
00478411   1/1  .dlvrlglkd.......gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddll
00495031   1/1  lggkvlyiglelt.lsperlrlraqsl...........................gldldellerllvidl
00437981   1/1  dgkdi............rrgiglvfqliglfphltvlelvalgl......ggilveevrellkel.....
00475371   1/1  Dirrpsarellg............................................llgellgldvlvga
00464791   1/1  pigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg..ligerprevrellglllelgvlf.....
00475521   1/1  dlv......dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddell
00426051   1/1  dgvdlggesglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprv
00371631   1/1  lgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeql.....k
00515531   1/1  tieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvle
00368501   1/1  laralakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllv
00475381   1/1  glrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll........................
00477971   1/1  trpprpg......evdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea.gldvlldi
00487021   1/1  ddllra.............gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..
00512891   1/1  dv.........rsarrgigyvfq........tveellgllaelvgle............vrgeleellkt
00434401   1/1  ddfyrpaaell..lreglgidfqlpdal......................drellreevlellglgevvi
00387201   1/1  tftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpe------
00379961   1/1  gnlsdlldpkdlrellragiplvflnfaalpasllesel...............................
00414121   1/1  geilidgqll....edlgvlavrlgigyvpqtlglfpaltvlellalall.............lredpdl
00478441   1/1  .dlvll......elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvglddr.
00477011   1/1  rptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpg
00515511   1/1  tieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvle
00533501   1/1  gepigtp........lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildr
00356411   1/1  eidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvl
00490731   1/1  Dpyrpaadellgvlaee............................................lgldvllga
00484101   1/1  digrldldellg.....igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilie
00368571   1/1  gelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgdgrsvrlnpla
00508671   1/1  gsgvvlldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalglelrdelrellke
00503741   1/1  TtLakllagllkpkfgeillfgkvvyvnvselldl...................................
00493431   1/1  treprpgev......rgigyvfqsgalfphlivagnllegaevhgllygtskerveeale....kgllvl
00451571   1/1  dl...........lreaiglvtqdgelllelidegilvpdeiviellrealeeldadgvildgfprllgq
00489571   1/1  ......................................................................
00496571   1/1  gepirgeplgelir......glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdl
00464411   1/1  epvsgeplge.......ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla
00468951   1/1  kaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid.......teesldqlrarrl
00437941   1/1  gidaselld.............................................................
00470731   1/1  kel..gagfilidgddlrekavgeleklgr.dlfqvaregglvpdilfideidall.......rkgpdvi
00379261   1/1  Akllga..pfvevdaselteg..gyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrli
00510561   1/1  DlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql......rarrlgldl
00532471   1/1  grdvgelggaalldivdegrliglvfqdldllpllevlellaa.......................rlee
00498811   1/1  gddlt....relvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldl
00404191   1/1  ....................................................................de
00498531   1/1  DallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql......rarrlgldl
00499191   1/1  ...............gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvv
00439861   1/1  tlalqlaanlaknggkvlyisle....esreqlleraerlgldleellllgll.................
00405881   1/1  pnlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasd................
00444381   1/1  rspairrllellgarpgenvlLvGppGtGKTtlakalakll..........gvpfiridgselte..kel
00406781   1/1  gvpfvrisa.............................................................
00489631   1/1  ridgddllrellgel...lgrgigfgfqqgdlledatvlenlalllldeidka.................
00392701   1/1  ................................................................sdllgk
00480251   1/1  lDpyrpsapeqlgilgellg.................vpvvgvltgldlagalrealell....llegyd
00480441   1/1  dttr.epregevlg...vdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glgvlldg
00432181   1/1  dptlgvveldgrkl........................................................
00513761   1/1  Dparanlpeqlgidirdlidletvmelglgpngalvfaleellttld....................ill
00394721   1/1  gvpv.........................................................vrldlsell
00499331   1/1  repvig............agtdigevfqdlllaggllvddev..............rrlllealdellla
00386741   1/1  ......................................................................
00402371   1/1  pfvrldaselle.......................................................fgk
00517691   1/1  ..................................................gtlllllgllsfllalvlds
00513251   1/1  dlr...................................................................
00420941   1/1  l..........gapfiridg..................................................
00515351   1/1  lreav............pggtdigelfqdyllfpfltvdeni..............rglllealeellaa
00437921   1/1  eldasdlrgvddl....religevlqalglllgg....................................
00416171   1/1  salte.......................................................dlleselfgh
00527261   1/1  kalakel..gkpviyidlselsskgyvdleellrelaeelgell.......................ell
00511381   1/1  ..kdaidtrlgielvvsriglvleavglffaldllelll...............................
00521551   1/1  ga...................................................................p
00473941   1/1  ................................................................pfiels
00437901   1/1  pvieidaselrd....................................................vddlsg
00533151   1/1  relvpggldig.............evfqda.leaglllfddefrglller..................le
00472911   1/1  rglageggkpl...........................................................
00409841   1/1  dpilgv................................................................
00430121   1/1  p.......sgvpfirinlselte...............................................
00367291   1/1  .........gapfirvdasellek..............................................
00461621   1/1  revvergtelgklikdyfdpgalvpdllirlllerllfldegg.gflldgfprtleqaeals........
00478081   1/1  dtddlrreairell.lgldlleilf.............................................
00496061   1/1  e............evepggtdlgeifqalllagel.lfddevlgll......rerldelielllagg.vv
00487061   1/1  iyepvdywaavgggdllrlirelllrlgfgepdafdn.ellgellealleg...................
00476071   1/1  egvllggpllerirellgegyllfdeal.............................drellaallfgle
00478391   1/1  gddllrelvgeggrlgrd....lfdedrllfrellideidl.............................
00519581   1/1  ellfgdvgglvvdli.......................................................
00509891   1/1  drdpgrld....................................ldeplgvdr.erlrrvgelalllagg
00495771   1/1  dgrhtT----------------------------------------------------------------
00418301   1/1  akll..........grpfirvdaselte..aelvGyesgarlrelf........................
00489391   1/1  ...............eavpggtdlgelfqdlllegellfidei.aelllealae................
00482551   1/1  lqlaanaalplelgklggkvlyisteeafsperlreralslgldleelldrllvidat............
00410531   1/1  ............................................gefv.dygptigvnfktvevdg.vkl
00401211   1/1  ...................................................................ldt
00469161   1/1  dgfgt...plgelirelllegfqdlilvpdllvlellaan..raglrelikellaagkgvildrfplsrl
00457851   1/1  lre.............avpggtrlgeviqdlfllggllffdeldel...........lkerieellaag.
00471271   1/1  Trdi------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  gkgvvvidtddlrr........................................alifqdeldlfdedre
00480501   1/1  .g.gvvvidgddlrralvggl..........................................idgllil
00414001   1/1  dpnlgv----------------------------------------------------------------
00478131   1/1  gddlrreavgqlglglsieelde........................alllpdalrrallee........
00516041   1/1  vidaddl..lrgeelgriielfdearelvpelallfideidellakgkvvildgtgrlleldealellgp
00477721   1/1  glpf..idtddll...relvgegielilelfd....................rarfrkllielldellaa
00378841   1/1  dvytktvei.dgkkvklqlwDtaGqerfrsllelyyrgadgillvvdvtdresfeelkkwleeilrlle.
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  esdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiv
00482721   1/1  ddlyrelvaggtplgerirellgegyllpdea.........lfrallaellfgdllalalldgvvydrlr
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  trdi------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  dpgtTigv..vgtveldgvklq------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQA
00390411   1/1  lrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarlle
00422801   1/1  lskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetrael
00379581   1/1  vlellelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakeg
00440861   1/1  dlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqd
00378981   1/1  drlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsea
00367901   1/1  vpqdpalfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeei
00420701   1/1  drlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsea
00490801   1/1  .........lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsg
00475891   1/1  alllllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakeg
00510251   1/1  ...........lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPt
00509431   1/1  elrr.ligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkele
00466931   1/1  llellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllg
00458601   1/1  lllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvll
00482201   1/1  tlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdls
00466971   1/1  llllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvl
00500441   1/1  dlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdl
00425571   1/1  lvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlseala
00530591   1/1  keaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellr
00482261   1/1  etlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdl
00404101   1/1  lvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthd
00475991   1/1  alralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrela
00502741   1/1  lpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrl
00436071   1/1  lvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlala
00361211   1/1  lglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakel
00469451   1/1  ldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvt
00485451   1/1  lelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelg
00424961   1/1  lladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdlll
00372301   1/1  ervgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvl
00468691   1/1  vlenlalgallag................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEpt
00498251   1/1  ........................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarell
00436511   1/1  lpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsrld
00367481   1/1  deiltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaell
00495371   1/1  leelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvt
00488521   1/1  gl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLk
00496111   1/1  drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilv
00503371   1/1  seyllnglgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeell
00532531   1/1  nrypselsgGqqqrv...........illldEPtsgLdpvsr..........................le
00379601   1/1  ..............laralrqdPdilllDEptsalda....e...llqallt.ghtvvlvthhlntaldl
00500611   1/1  gllelldrlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvl
00422141   1/1  lglsy....gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp........
00448931   1/1  liDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda.....lrellellrelgltvlv
00457311   1/1  pevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirl
00381441   1/1  dreraeellellgldadlviilpasleellerldrrggelsggqkqRvala-------------------
00485931   1/1  liDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda.....lrlllellkelgltvlv
00468601   1/1  lvgelsggqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgtakgg
00462761   1/1  lrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviith
00480471   1/1  kydpvilllnkidllddrllrraeaeerieellelv----------------------------------
00478411   1/1  drypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.ldiilalelllld-
00495031   1/1  lelvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvt
00437981   1/1  .......lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsel
00475371   1/1  rggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdlda
00464791   1/1  .........................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvl
00475521   1/1  ldrlp...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlv---------------
00426051   1/1  iellle.gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadtee
00371631   1/1  rigllfq.kglpealdveell...................ellldl.kegledilvpvlsggqkqrlala
00515531   1/1  nlanvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalaral-------------
00368501   1/1  seligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdge
00475381   1/1  llgglvvildggvrqrlalarallldpdvllldeplllldaalr...........dlpdlvifldadpe-
00477971   1/1  dpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleeale
00487021   1/1  lldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvif
00512891   1/1  likelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldelela
00434401   1/1  vdvydlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdleval-
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ......lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragit
00414121   1/1  ilid.........sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvl
00478441   1/1  ..ypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl..lgidallelvdr----
00477011   1/1  lpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesdalellkelleeg.
00515511   1/1  nlanvpillvlnKiDlleaklvllllvglfdlldglpselsggqkqrvalaral----------------
00533501   1/1  vglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekr
00356411   1/1  envpiilvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalaralakdpdil--------
00490731   1/1  rggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgle
00484101   1/1  Gllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllell--------
00368571   1/1  liddeedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselg.........
00508671   1/1  aglpll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi...------------
00503741   1/1  ........kellrlllealglp.....ppyqlsggerlrvalaeallalgkpdllilDEitnlldpetls
00493431   1/1  ldrdlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnd
00451571   1/1  aelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild--------
00489571   1/1  ..........lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvthldeaer
00496571   1/1  aygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrlrlgdteevlehrleraeeladr
00464411   1/1  ..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrlehylela
00468951   1/1  gldlddllllpaltveellala...............................erllsggkpqlvviDsl
00437941   1/1  ...pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeld
00470731   1/1  ldgagrtpeqlealldlleelgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleil
00379261   1/1  gappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllelldd
00510561   1/1  drlllldaltv...............................eellalaerllsggkvdlvviDsltala
00532471   1/1  llerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviy
00498811   1/1  lgldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadiv
00404191   1/1  lvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeel
00498531   1/1  dellllpaltveellala...............................erllsggkpdlvviDsltala
00499191   1/1  lldryprllsggqrqrvaia.....dpdvlildgptllldpe...........lrpladlvifldaspe-
00439861   1/1  .................siliadplglsgeellrvllalalelkpdlliiDeltalldaervrelrellr
00405881   1/1  .......plldqpvellsggekqrlalarallgkpvilvlNKiDeptnel.......dlellelleelgg
00444381   1/1  vGe..................................................segailsggfkqrvgia
00406781   1/1  ......sellgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlr
00489631   1/1  ....ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarl
00392701   1/1  yvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvt
00480251   1/1  vvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaa
00480441   1/1  fprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnd
00432181   1/1  ....vliDtpGleefa.sggekqrvalalallreadvlllvvdadeptsfldle....ll----------
00513761   1/1  ealell..eedydyiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllell
00394721   1/1  svsdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattn
00499331   1/1  ggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryee
00386741   1/1  pfvrldaselsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldg
00402371   1/1  yvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleegnvrvia------
00517691   1/1  lplerergitidvalarllldgrkilllDtP.Ghed.....fvkevlralrladgallvvdadegvslpq
00513251   1/1  .......gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierl
00420941   1/1  .......sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrre------
00515351   1/1  g.kvvildglsggllqrvallrallrpdlvifldapleelleRllkRd.dseeeilerleryreelepll
00437921   1/1  ........................kpdvlllDEi.drldpdaqnallklleel.pagvtlilttnrle..
00416171   1/1  ekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggivlpadvr
00527261   1/1  kkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqsll.dvsskelleaL
00511381   1/1  .....................qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfage
00521551   1/1  fvrlsaselvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrv------
00473941   1/1  asdllg..esdlrggfkqa........akpgvlflDEidrl.....drevqnaLlelleelqvt------
00437901   1/1  yvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliilttndp
00533151   1/1  ellargpvvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrle
00472911   1/1  gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifldadpev
00409841   1/1  .................vlldgrdllllDtPGlidfaseptnlldlei...ieallraleeadvvllvvd
00430121   1/1  .kllvselighppg.yvGedelgvlfeaarkappsvlllDEidkl.....dpdvlnaLlqllee------
00367291   1/1  .............lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaL------
00461621   1/1  .....kpavlsggrkqrlalaralavdpe.lildg.............rllgrrllplpdlvifldaspe
00478081   1/1  eglllsdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevll
00496061   1/1  ildgfpldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevlekrlerylel
00487061   1/1  .......................gkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyl
00476071   1/1  legalldglvygvlqdrllerllaagpdvlildgpl.lld...........vellplpdlvifldappev
00478391   1/1  ....................llakgkvvildgtn.....lsealdealrrllr..pdlvifldapleell
00519581   1/1  ........dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifithde
00509891   1/1  glcalvaddlagaleel.laralaggpdviliE...gagllplp.....liellrdlldlvvlvvldgiv
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ...........................aragigllaladpgvlflDEidkllpargssggdvsredvlna
00489391   1/1  ..........................aegkvvildgtg..ldieqrealrelllel.prpdlvifldad-
00482551   1/1  ................dlldllellerlrrllsegkvdlvviDslallarael..ldepllg--------
00410531   1/1  viwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvg--------
00401211   1/1  lkgelergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhe......dflkell
00469161   1/1  .ayqlsggerqrlaidlegalllerllldep.......................................
00457851   1/1  gvildgfpldlegaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrel
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  egfrvpeelvrellkel.larllaeggdvvilDgt.....nltleqrealrrllkelgrpdlviyldapd
00480501   1/1  fledeaalselvlevllealegggnpdvvildgt.....nlleedrellrellkrlgrpdlvifldaple
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ...............alealkag.dvvild..gfgrslaarqlllellrelgrvvkpdlvifldappevl
00516041   1/1  .dlvifldappeelleRllkr.....................gldeeaieerlerlreilepleeaddlv
00477721   1/1  ggvvldlgrtlllrralrellreldlvvfldapleelleRllkRggrfdllielplleelkeilrellpl
00378841   1/1  agvpiilvgnKiDllgrqvlveearalakelgiplf..etSaktgegvdelfeal---------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  eelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakala------
00482721   1/1  dellaelsggqgdvliiegalllepgllplpdlvifldap..pevlleRllkRg.gdseeeiekrleryr
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGII
00390411   1/1  lleglkeeaeka----------------------------------------------------------
00422801   1/1  lellrelak.gltvllvth---------------------------------------------------
00379581   1/1  ltvllvthdldealrladrilvlddGrivelgtpeel---------------------------------
00440861   1/1  pnlfpglvvlisaltgegldeltvrenlal----------------------------------------
00378981   1/1  lrladrilvlddGrivelgtpee-----------------------------------------------
00367901   1/1  eeraeellellglgglldr---------------------------------------------------
00420701   1/1  lrladrilvlddGrivelgtpee-----------------------------------------------
00490801   1/1  LDpetraellellrelakegktvllv--------------------------------------------
00475891   1/1  ltvllvthdldealrladrilvlddGrivelgtp------------------------------------
00510251   1/1  sgLDpetraellellrelakegktvl--------------------------------------------
00509431   1/1  eeleligplldglellvglngll-----------------------------------------------
00466931   1/1  lgdlldrpvstLSGGerqr---------------------------------------------------
00458601   1/1  vtHdldealrladrilvlddGrivee--------------------------------------------
00482201   1/1  earladrilvlddGrivelgtpeellenpgllytlll---------------------------------
00466971   1/1  lvthdldealrladrilvld--------------------------------------------------
00500441   1/1  sealrladrilvlddGrivelgt-----------------------------------------------
00425571   1/1  ladrilvlddGrivelgtpeell-----------------------------------------------
00530591   1/1  elak.gltvllvtHdlsealladrilvlddGrivee----------------------------------
00482261   1/1  sealladrilvlddGrivelgtpeel--------------------------------------------
00404101   1/1  ldealrladrilvlddGrivelgtpeellenp--------------------------------------
00475991   1/1  kegltvllvtHdlsealrladrilvlddGrive-------------------------------------
00502741   1/1  adrilvlddGrivelgtpeellenpg--------------------------------------------
00436071   1/1  ladrivvl--------------------------------------------------------------
00361211   1/1  gvtvilvthdldlldsallrp-------------------------------------------------
00469451   1/1  H.......Asdrv---------------------------------------------------------
00485451   1/1  rtiilvthdlreae.adrilvlrk----------------------------------------------
00424961   1/1  lDeptsalDgeivlsllla---------------------------------------------------
00372301   1/1  fvtHdlelaalladrvvvlndgriv---------------------------------------------
00468691   1/1  sgldalr.e.ilellrellkelgyt---------------------------------------------
00498251   1/1  ellrrllrlakelgvtvllvthdlde--------------------------------------------
00436511   1/1  er--------------------------------------------------------------------
00367481   1/1  gatvlvvtHdlelaalaadri-------------------------------------------------
00495371   1/1  hdleeveeladrva--------------------------------------------------------
00488521   1/1  rlakelgvtvllvthdlde---------------------------------------------------
00496111   1/1  thdleeaedladsgriavladgrivlegdlaelgl-----------------------------------
00503371   1/1  klleeleellkele--------------------------------------------------------
00532531   1/1  ladriyvllsGrivesgtteelltepkatfsacfaap---------------------------------
00379601   1/1  adriivlddGriveegtpeellan----------------------------------------------
00500611   1/1  lvthdlreveel----------------------------------------------------------
00422141   1/1  ........ieyvfqspnlfp--------------------------------------------------
00448931   1/1  vthlDllakggadlslaleladrilvlgdG----------------------------------------
00457311   1/1  itrdlgeagrsadrvl....--------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  vthddgtakggaalslaleladrilvlgd-----------------------------------------
00468601   1/1  hdlslalrladrilvlgvGeivedgtpfel----------------------------------------
00462761   1/1  dlsieevadrilalleg-----------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  vilvthdlreve----------------------------------------------------------
00437981   1/1  lpallsrcqvi-----------------------------------------------------------
00475371   1/1  vlkaadrilvldlggivlnkldlvakggaalelaeelgvpllsiplgegiddlldf--------------
00464791   1/1  lllDEptsgldal.r-------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ellellerlar-----------------------------------------------------------
00371631   1/1  ralvedpdvlilDgptal----------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  llkalkeaeaeellellglkdlllrkp-------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  lldrilvl--------------------------------------------------------------
00487021   1/1  ldadp-----------------------------------------------------------------
00512891   1/1  driallrrgrivelgplseeelleilrrrl----------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  lllpagvtvia-----------------------------------------------------------
00414121   1/1  ivlnKiDllselthdl------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  .krtivvvtKiDlld-------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  lehylel---------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  aadrilvlleglgvpgvvlNkldlvaeggaalelleelgvpilsaltgegvddll---------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  .......lrdladrle------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  pdvlelLlrlleegkltdkllgltliltthdldllerladrllsrfngkgivielpplseeelleilkkr
00493431   1/1  dleealeelldiivvlllglilqpgsl-------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  .aDrvavldd.....Gtpee--------------------------------------------------
00496571   1/1  lialyegavvv-----------------------------------------------------------
00464411   1/1  epykdd----------------------------------------------------------------
00468951   1/1  talrpalllldep---------------------------------------------------------
00437941   1/1  pallsRfdviefpppdeee---------------------------------------------------
00470731   1/1  krllkklgtvld----------------------------------------------------------
00379261   1/1  vgltdll---------------------------------------------------------------
00510561   1/1  palelsllldept---------------------------------------------------------
00532471   1/1  ldadpeel--------------------------------------------------------------
00498811   1/1  idndlslee-------------------------------------------------------------
00404191   1/1  dqallrllsrldrvivldlppdl-----------------------------------------------
00498531   1/1  pslllldepgrvt---------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  alkrlakelg------------------------------------------------------------
00405881   1/1  tvvlvSahdgegldelldail-------------------------------------------------
00444381   1/1  ..lladpgilflDEidkllddrgeaeg-------------------------------------------
00406781   1/1  lleelrlls-------------------------------------------------------------
00489631   1/1  eeryradlvivt----------------------------------------------------------
00392701   1/1  viattnrpeel-----------------------------------------------------------
00480251   1/1  lgaalsvalilglpilflg---------------------------------------------------
00480441   1/1  dleealellla-----------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  lklgipiilv------------------------------------------------------------
00394721   1/1  rpellgr---------------------------------------------------------------
00499331   1/1  ltrdlielyee-----------------------------------------------------------
00386741   1/1  lllpsgvlviattnrpel..ldp-----------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  trevll----------------------------------------------------------------
00513251   1/1  ldrvllldeg------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  eeyddalvvida----------------------------------------------------------
00437921   1/1  ellpallsrfd.iiefkplseee-----------------------------------------------
00416171   1/1  liaatnp---------------------------------------------------------------
00527261   1/1  lrl-------------------------------------------------------------------
00511381   1/1  lfegsll---------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  e..eldpallrRfd.iiefpppd-----------------------------------------------
00533151   1/1  rylklyerlie-----------------------------------------------------------
00472911   1/1  lleRllkrgrall---------------------------------------------------------
00409841   1/1  adrgll----------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  elleRllkrgrerg--------------------------------------------------------
00478081   1/1  eRllkRgrrerkddseevlellekrleryepllel.........yeead---------------------
00496061   1/1  yerliepy--------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  lleRllkRggdsleeiek----------------------------------------------------
00478391   1/1  eRllkrgrh-------------------------------------------------------------
00519581   1/1  delrerialraeeldkdglleelrklldlidkydalkv--------------------------------
00509891   1/1  llvdaidrleaad---------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  Llrlleegeltilgggvdlpnvlviaatnpdly....rpdeldpallrRfdlvi----------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ralala----------------------------------------------------------------
00469161   1/1  .....fpdlvifldaspee---------------------------------------------------
00457851   1/1  yerliepyeead----------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  eelleRll--------------------------------------------------------------
00480501   1/1  ellerll---------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  leRllkRg--------------------------------------------------------------
00516041   1/1  idtanldleevveei-------------------------------------------------------
00477721   1/1  ykeladlv--------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  eiaplleaadlvid--------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGIASVVSIVVVGDAAKQMVLADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQLWVNSATP
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  lfeagvel......vfddealell----------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVSKSLRLRYGNIDIAVNANGVSGDYFNVYGMSFREGNTFNDVQQQDRAQVVVLDANTRRQLFPNKANVV
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGVDSDQAEQQLT
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMA
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           VGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQLFLPGWEIGFSLTALASAFLCSTFTGILFGW
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LPARNAARLDPVDALARE----------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------