[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for sent8:ACF69516.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   4::107  4.1e-12 34.4% 0043518 00435181 1/1   drug resistance efflux transporter EmrE 
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPML
00435181   1/1  ---lrlllaallllpfalllkls........pgrtwllllllgllltalaflllflalkrlpaglayall


                         -         -         *         -         -         -         -:140
query           SLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA-----------------------------
00435181   1/1  lylgpvfaallgwlllgErlsllqllGialilaGvll---------------------------------